GapMind for catabolism of small carbon sources

 

Protein H281DRAFT_05513 in Paraburkholderia bryophila 376MFSha3.1

Annotation: H281DRAFT_05513 branched-chain amino acid transport system permease protein

Length: 597 amino acids

Source: Burk376 in FitnessBrowser

Candidate for 27 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-isoleucine catabolism livG med ABC transporter ATP-binding protein (characterized, see rationale) 41% 95% 195.3 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-leucine catabolism livG med ABC transporter ATP-binding protein (characterized, see rationale) 41% 95% 195.3 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-phenylalanine catabolism livG med ABC transporter ATP-binding protein (characterized, see rationale) 41% 95% 195.3 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-proline catabolism HSERO_RS00895 med ABC transporter ATP-binding protein (characterized, see rationale) 41% 95% 195.3 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-serine catabolism Ac3H11_1693 med ABC transporter ATP-binding protein (characterized, see rationale) 41% 95% 195.3 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-tyrosine catabolism Ac3H11_1693 med ABC transporter ATP-binding protein (characterized, see rationale) 41% 95% 195.3 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-valine catabolism livG med ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 41% 98% 188 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-alanine catabolism braF med NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 40% 93% 174.9 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-histidine catabolism natA med NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 40% 93% 174.9 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-leucine catabolism natA med NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 40% 93% 174.9 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-proline catabolism natA med NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 40% 93% 174.9 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-serine catabolism braF med NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 40% 93% 174.9 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-threonine catabolism braF med NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 40% 93% 174.9 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-isoleucine catabolism natA lo NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 39% 95% 171.4 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-valine catabolism natA lo NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 39% 95% 171.4 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
D-alanine catabolism AZOBR_RS08245 lo Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 37% 88% 159.5 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-proline catabolism AZOBR_RS08245 lo Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 37% 88% 159.5 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-arginine catabolism braF lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 37% 90% 154.8 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-glutamate catabolism braF lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 37% 90% 154.8 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-histidine catabolism braF lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 37% 90% 154.8 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-isoleucine catabolism livM lo High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M (characterized) 31% 80% 146.7 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-leucine catabolism livM lo High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M (characterized) 31% 80% 146.7 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-phenylalanine catabolism livM lo High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M (characterized) 31% 80% 146.7 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-valine catabolism livM lo High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M (characterized) 31% 80% 146.7 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-arginine catabolism braE lo Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 32% 65% 136 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-glutamate catabolism braE lo Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 32% 65% 136 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7
L-histidine catabolism braE lo Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 32% 65% 136 ABC amino acid transporter, ATP-binding, component of Uptake transporter, CamABCD of cholate (steroid) metabolites, 1β(2'-propanoate)-3aα-H-4α(3"(R)-hydroxy-3"-propanoate)-7aβ-methylhexahydro-5-indanone and a desaturated analog 35% 309.7

Sequence Analysis Tools

View H281DRAFT_05513 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSAEQNALGLRRARKAPYFLCAILLAGLPWIWSGGFGIHIAQSFCYTAIAVIGVNLLVGL
SGQMSLGQAAFYAIGAYASVLTSLKLGWPIAASVLFGVAVAAAVGTVVGVFALRTRGLYL
AMTTLAVGFVVSILAQRWVGLTGGTMGLSGVPQVDFGDTIHGEIWYLYVVGGTLLVVQIL
NDYVFDSRIGRCLLATRDSEAFAASVGIKVPIVRSAIFAVSAALAGLSGGLFAHQSGFVG
SDAFSVTLSLSLLIAAVIGGLGARIGPLAGTAILMTIVELVAGLDRYGLMVYGGIMLLVL
LVFPQGAAGIVDIWRKPKSARKGSPSPENRSEAIARVDLQLDGCSLTVESVSKQYGGVLA
VSDVSFSVAAGQIHGLIGPNGAGKSTLVNLIAGNYLCDSGRVRLDGADVSNLVTADRAKR
GLARTFQNLQLVEALPVLENVLLGMSSADGHVANFAKWWMGRAFDLPERREALEILAFFG
IEHLCQAYPTELSYGHRKLVELARAIAQRPRLMLLDEPIAGLNGAEAMEVAKVVGRLRDA
GVTILLIEHNMEFVMSLCDSISVLEQGRLIGTGTPEEIRSDERILRAYLGTDEAMKC

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory