Align cyclohexa-1,5-dienecarbonyl-CoA hydratase (EC 4.2.1.100) (characterized)
to candidate H281DRAFT_01200 H281DRAFT_01200 short chain enoyl-CoA hydratase (EC 4.2.1.17)
Query= BRENDA::D3RXI0 (252 letters) >FitnessBrowser__Burk376:H281DRAFT_01200 Length = 278 Score = 104 bits (259), Expect = 2e-27 Identities = 75/246 (30%), Positives = 116/246 (47%), Gaps = 10/246 (4%) Query: 14 VARIKIANPPVNVLDMETMKEIISAIDEVEG---VDVIVFSGEG-KSFSAGAEIKEHFPD 69 VA++ + PP N + + ++ ++ + G V IV +GEG K FSAGA++ F D Sbjct: 12 VAQLTLKRPPANAFTPDGLLQLQQTVERLNGETRVRAIVITGEGPKFFSAGADLNA-FAD 70 Query: 70 KAPEMIRW----FTQLIDKVLRCKAITVAAVKGFALGGGFELAIACDFVLASKNAKLGVP 125 E+ R F + + + + +AA+ GFA+GGG E A+ACD +A ++A + +P Sbjct: 71 GNREVARVAAARFGAAFEALQNARPVVIAAINGFAMGGGLECALACDIRIAEQHAVMALP 130 Query: 126 EITLAHYP-PVAIALLPRMIGWKNAYELILTGEAITAERAFEIGLVNKVFEDENFEESVN 184 E + P LP ++G A +ILTGE + A A IGLV +V E E+ Sbjct: 131 ETAVGLLPCGCGTQTLPWLVGEGWAKRMILTGERVDAATALRIGLVEEVVEKGAAREAAL 190 Query: 185 DFVNSLLEKSSVALRLTKKALLFSTEKEYLSLFDVINDVYLSQLVKSEDAVEGLKAFLEK 244 + S A+ +K + S + L D EG+ AFLEK Sbjct: 191 SMAARVATLSPQAVGFSKTLIHQGRNGVPRSAALALERERFVDLFDGADQREGVNAFLEK 250 Query: 245 RKPEWK 250 R P W+ Sbjct: 251 RTPRWQ 256 Lambda K H 0.318 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 278 Length adjustment: 25 Effective length of query: 227 Effective length of database: 253 Effective search space: 57431 Effective search space used: 57431 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory