Align cyclohexa-1,5-dienecarbonyl-CoA hydratase monomer (EC 4.2.1.100) (characterized)
to candidate H281DRAFT_05725 H281DRAFT_05725 short chain enoyl-CoA hydratase
Query= metacyc::MONOMER-18320 (256 letters) >FitnessBrowser__Burk376:H281DRAFT_05725 Length = 258 Score = 125 bits (315), Expect = 7e-34 Identities = 84/263 (31%), Positives = 125/263 (47%), Gaps = 12/263 (4%) Query: 1 MGFNTILFEKKDKVATITLNVPNS-NWLTIPMMKEINEALMDVKKDPTIQLLVFDHAGDK 59 M + IL E + +V +TLN P + N L +M E+ AL + D I +V +K Sbjct: 1 MVYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVLT-GSEK 59 Query: 60 AFCDGVDVADHVPEKVDEMIDLFHGMFRNMAAMDVTSV-----CLVNGRSLGGGCELMAF 114 AF G D+ +D++ G + V S+ V G +LGGGCEL Sbjct: 60 AFAAGADIG---MMSTYSYMDVYKGDYITRNWETVRSIRKPIIAAVAGFALGGGCELAMM 116 Query: 115 CDIVIASEKAKIGQPEINLAVFPPVAAAW-FPKIMGLKKAMELILTGKIISAKEAEAIGL 173 CD++ A++ AK GQPEI L + P P+ + KAM+L LT + + A EAE GL Sbjct: 117 CDMIFAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGL 176 Query: 174 VNVVLPVEGFREAAQKFMADFTSKSRPVAMWARRAIMAGLNLDFLQALKASEIIYMQGCM 233 V+ V+P + A A P M + ++ + + ++ Sbjct: 177 VSRVIPAASLIDEAIAAAATIAEFPLPAVMMVKESVNRAYETTLAEGVHFERRLF-HSLF 235 Query: 234 ATEDANEGLASFLEKRKPVFKDK 256 ATED EG+A+F+EKRKPVFK + Sbjct: 236 ATEDQKEGMAAFVEKRKPVFKHR 258 Lambda K H 0.322 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 258 Length adjustment: 24 Effective length of query: 232 Effective length of database: 234 Effective search space: 54288 Effective search space used: 54288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory