Align 3-hydroxybutyryl-CoA dehydratase; EC 4.2.1.55 (characterized)
to candidate H281DRAFT_01200 H281DRAFT_01200 short chain enoyl-CoA hydratase (EC 4.2.1.17)
Query= CharProtDB::CH_091794 (261 letters) >FitnessBrowser__Burk376:H281DRAFT_01200 Length = 278 Score = 164 bits (416), Expect = 1e-45 Identities = 97/244 (39%), Positives = 136/244 (55%), Gaps = 2/244 (0%) Query: 11 EGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDSEVLAVILTGAGEKSFVAGADISE 70 EG VA +T+ RP A NA D L ++ + + ++ V A+++TG G K F AGAD++ Sbjct: 9 EGAVAQLTLKRPPA-NAFTPDGLLQLQQTVERLNGETRVRAIVITGEGPKFFSAGADLNA 67 Query: 71 MKEMNTIEGRKFGILGNKVFRRLELLEKPVIAAVNGFALGGGCEIAMSCDIRIASSNARF 130 + N R F L+ VIAA+NGFA+GGG E A++CDIRIA +A Sbjct: 68 FADGNREVARVAAARFGAAFEALQNARPVVIAAINGFAMGGGLECALACDIRIAEQHAVM 127 Query: 131 GQPEVGLGITPGFGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLVNKVVEPSELMN 190 PE +G+ P GTQ L LVG G AK++I T + + A ALRIGLV +VVE Sbjct: 128 ALPETAVGLLPCGCGTQTLPWLVGEGWAKRMILTGERVDAATALRIGLVEEVVEKGAARE 187 Query: 191 TAKEIANKIVSNAPVAVKLSKQAINRGMQ-CDIDTALAFESEAFGECFSTEDQKDAMTAF 249 A +A ++ + +P AV SK I++G ALA E E F + F DQ++ + AF Sbjct: 188 AALSMAARVATLSPQAVGFSKTLIHQGRNGVPRSAALALERERFVDLFDGADQREGVNAF 247 Query: 250 IEKR 253 +EKR Sbjct: 248 LEKR 251 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 278 Length adjustment: 25 Effective length of query: 236 Effective length of database: 253 Effective search space: 59708 Effective search space used: 59708 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory