Align 2-pyrone-4,6-dicarboxylate lactonase (EC 3.1.1.57) (characterized)
to candidate H281DRAFT_06139 H281DRAFT_06139 Predicted metal-dependent hydrolase, TIM-barrel fold
Query= BRENDA::D1MW98 (305 letters) >FitnessBrowser__Burk376:H281DRAFT_06139 Length = 318 Score = 166 bits (421), Expect = 5e-46 Identities = 97/290 (33%), Positives = 142/290 (48%), Gaps = 14/290 (4%) Query: 13 WYANPSKPQFKLPAGAVDAHCHVFGPGNEFPFAPERKYTPCDASKAQLYALRDHLGFARN 72 W A + K+P A D H H++ + P+A E P +A+ A L+ +G RN Sbjct: 39 WSAGTEPARVKMPPNATDCHHHIYD--HSHPWASEATLKPGNATVADYRRLQMRVGTTRN 96 Query: 73 VVVQATCHGADNRAMVDACKSSGGKARGVATVKRSISDAELQELHDAGVRGVRFNFVKRL 132 V++Q + +G DNR ++ A G+ARG+A V S++ EL ELH GVRG+RFN Sbjct: 97 VIIQPSSYGVDNRLLLAAIAEFEGRARGIAVVNTSVTQQELIELHKGGVRGIRFNLAP-- 154 Query: 133 VDFTPKDELMEIAGRIAKLGWHVVIYFEAVDLPELWDFFTALPTTVVVDHMGRPDVTKGV 192 T D + +A RIA +GWH+ + AV L D + LP VV DH+ + Sbjct: 155 PGTTTLDMVKPLARRIAPMGWHIQVNAPAVYLLNARDTWGDLPCPVVFDHLAHIPEPDAI 214 Query: 193 DSEEFALFLKFMREHKNVWSKVSCPERLSVSGPKALHGEQNAYQDVVPFARRVVEEFPER 252 F++ + + K V P Y D V A + P+R Sbjct: 215 HHPAFSMVTELLLSKKAYVKLTGFYNDTKVGPP--------TYSDSVVVAAAYAQAAPDR 266 Query: 253 VLWGTDWPHPNLKDH--MPDDGLLVDFIPHIAPTAQLQQKLLVDNPMRLY 300 VLWG+DWPHP + H +PDD LL + I + P + + ++LVDNP +LY Sbjct: 267 VLWGSDWPHPTEQPHNQIPDDALLTNLITTVVPNSSRRDQMLVDNPRKLY 316 Lambda K H 0.321 0.138 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 318 Length adjustment: 27 Effective length of query: 278 Effective length of database: 291 Effective search space: 80898 Effective search space used: 80898 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory