Align Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase; HMG aldolase; EC 4.1.3.17; Oxaloacetate decarboxylase; OAA decarboxylase; EC 4.1.1.112; Regulator of ribonuclease activity homolog; RraA-like protein (uncharacterized)
to candidate H281DRAFT_06356 H281DRAFT_06356 RraA famliy
Query= curated2:Q9KBI9 (210 letters) >FitnessBrowser__Burk376:H281DRAFT_06356 Length = 222 Score = 139 bits (351), Expect = 3e-38 Identities = 72/192 (37%), Positives = 113/192 (58%), Gaps = 1/192 (0%) Query: 3 QAEIDFITQFRTIPTTCISDALDGLTNLTSTIKPLNENDQVVGPARTVQVASGDNLAVLK 62 QA + R + + +SD + + + ++P + + G A TV GDNLA+ + Sbjct: 14 QAGAATLGALRELAVSLLSDNMARTSGMLG-LRPYHRPKPLAGTAVTVHTRPGDNLAIHR 72 Query: 63 AMYEASPGDVIVIDAKGDCTRAIAGDFVLGMAKTLGIAGFVVDGAIRDIRASKALNFPIF 122 A PGDV+VID GD T+A+ G+ + A++LG+ G V+DGAIRD+ A +FP++ Sbjct: 73 AFDFCRPGDVLVIDGAGDLTQALMGEIMASFAQSLGVEGLVIDGAIRDVGALGQRDFPVY 132 Query: 123 CRGTTIAASKKTGIGNINVPISCGGVPIRPGDLIVGDADGVTVIPKGQEENVLQKAKKKQ 182 RG T K G G INVP++ GG+ + PGD+IVGD DG+ I E V++ A+++Q Sbjct: 133 ARGVTHRGPYKNGPGEINVPVTVGGMVVHPGDIIVGDEDGLLAIAPADAEAVIEGARRQQ 192 Query: 183 ADDEARERAISD 194 A + A ++I+D Sbjct: 193 AKEMAALKSIAD 204 Lambda K H 0.318 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 210 Length of database: 222 Length adjustment: 22 Effective length of query: 188 Effective length of database: 200 Effective search space: 37600 Effective search space used: 37600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory