Align 4-oxalomesaconate tautomerase; Gallate degradation protein D; EC 5.3.2.8 (characterized)
to candidate H281DRAFT_01376 H281DRAFT_01376 4-oxalomesaconate tautomerase
Query= SwissProt::Q88JY0 (361 letters) >FitnessBrowser__Burk376:H281DRAFT_01376 Length = 368 Score = 465 bits (1196), Expect = e-135 Identities = 241/359 (67%), Positives = 280/359 (77%), Gaps = 5/359 (1%) Query: 3 QTRIPCLLMRGGTSKGAYFLHDDLPAPGPLRDRVLLAVMGSPDARQIDGIGGADSLTSKV 62 QTRIPC+++RGGTSKGA+F+ DLPA RDRVLLAVMGSPD RQIDGIGGAD LTSKV Sbjct: 6 QTRIPCMMIRGGTSKGAFFMASDLPAEPAERDRVLLAVMGSPDPRQIDGIGGADPLTSKV 65 Query: 63 AIIRASQRDDADVDYLFAQVVVDEARVDYGQNCGNILAGVGPFALERGLVAASGASTPVR 122 AII S R+DADVDYLFAQVVV+EARVD+GQNCGNILAGVGP+A+ERGLV A ST V Sbjct: 66 AIISPSSREDADVDYLFAQVVVNEARVDFGQNCGNILAGVGPYAIERGLVNAEDGSTRVA 125 Query: 123 IFMENTGQIAVAQVPTADGQVEYAGDTRIDGVPGRAAALVVTFADVAGASCGALLPTGNS 182 I M NTGQIAVA V T +V Y GD RIDGVPG AA + + F D AG++CGALLPTG Sbjct: 126 IHMVNTGQIAVATVRTPGCRVTYEGDARIDGVPGGAAPIPLEFRDTAGSTCGALLPTGRL 185 Query: 183 RDCVEGVEVTCIDNGMPVVLLCAEDLGVTGYEPCETLEADSALKTRLEAIRLQLGPRMNL 242 +D VEGVE+TCIDNGMP+VL+ A DL TGYE E L+AD+ LK R+E IRL +GP MNL Sbjct: 186 KDTVEGVELTCIDNGMPLVLMRARDLQRTGYETREELDADNELKARIEKIRLVVGPMMNL 245 Query: 243 GDVSQRNVPKMCLLSAPRNGGTVNTRSFIPHRCHASIGVFGAVSVATACLIEGSVAQGLA 302 GDVS R VPKMCL++ PRNGGT++TRSFIPHRCHASIGV GAVSVATA ++ G+V G+A Sbjct: 246 GDVSARTVPKMCLVAEPRNGGTISTRSFIPHRCHASIGVLGAVSVATAAVLPGTVCDGIA 305 Query: 303 STS-GGDRQRLAVEHPSGEFTVEISL----EHGVIKGCGLVRTARLLFDGVVCIGRDTW 356 G R+R++VEHP+GEFTVE++L E + L+RTAR LFDGVV I W Sbjct: 306 KVELEGARKRVSVEHPTGEFTVELTLGGEPERPEVLSAALLRTARWLFDGVVGIPSSVW 364 Lambda K H 0.320 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 516 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 368 Length adjustment: 29 Effective length of query: 332 Effective length of database: 339 Effective search space: 112548 Effective search space used: 112548 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory