Align Enoyl-CoA hydratase (characterized, see rationale)
to candidate H281DRAFT_02514 H281DRAFT_02514 enoyl-CoA hydratase
Query= uniprot:A0A2Z5MEB0 (258 letters) >FitnessBrowser__Burk376:H281DRAFT_02514 Length = 258 Score = 283 bits (724), Expect = 3e-81 Identities = 145/250 (58%), Positives = 184/250 (73%) Query: 9 ETRGRVGLVTLSRPKALNALNDALMDELGVALREFDADDAIGAIVLTGSEKAFAAGADIG 68 E RGRV LV L+ LN L DALMD+L L +AD + A VLTGS KAFAAGADI Sbjct: 9 ERRGRVALVRLASDNPLNPLTDALMDQLIDVLLRNEADPQVHATVLTGSGKAFAAGADIV 68 Query: 69 MMSTYSYMDVYKGDYITRNWETVRSIRKPIIAAVAGFALGGGCELAMMCDMIFAADTAKF 128 MS Y + + DYI R+W+ +R++RKPIIAAV G+ALGGGCELAMMCD++ AAD A F Sbjct: 69 AMSKLDYANAFSDDYIGRSWDRIRTVRKPIIAAVGGYALGGGCELAMMCDIVIAADDALF 128 Query: 129 GQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLVSRVIPAASLID 188 GQPEIKLGI+PGAGGTQRLPRAV K+ AM CLT + A EA GLVS+++ LID Sbjct: 129 GQPEIKLGIVPGAGGTQRLPRAVGKSTAMLACLTGEPLGAQEALAYGLVSKIVARERLID 188 Query: 189 ESIAAGATIAEFPLPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATEDQKEGMAAFV 248 E++ G IA LP ++ +KE+V+RA+E++L+EG+ FERRLFH+ F+ DQKEGMAAF+ Sbjct: 189 EAMRVGEQIARHSLPVIVAIKEAVDRAFESSLSEGLLFERRLFHAGFSLADQKEGMAAFL 248 Query: 249 EKRKPVFKHR 258 E+R+ F++R Sbjct: 249 ERRQAAFQNR 258 Lambda K H 0.322 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 258 Length adjustment: 24 Effective length of query: 234 Effective length of database: 234 Effective search space: 54756 Effective search space used: 54756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory