Align 3-oxoadipate enol-lactonase (EC 3.1.1.24) (characterized)
to candidate H281DRAFT_02073 H281DRAFT_02073 3-oxoadipate enol-lactonase (EC 3.1.1.24)
Query= BRENDA::Q13KT2 (263 letters) >FitnessBrowser__Burk376:H281DRAFT_02073 Length = 262 Score = 176 bits (446), Expect = 4e-49 Identities = 93/257 (36%), Positives = 134/257 (52%), Gaps = 6/257 (2%) Query: 6 VNGTELHYRIDGERHGNAPWIVLSNSLGTDLSMWAPQVAALSKHFRVLRYDTRGHGHSEA 65 +NG E Y + E G PW+ + LG DLS+W + VLRYD RGHG +E Sbjct: 5 INGIETRYVLSNE--GGGPWLTFIHQLGGDLSVWDQLAGYFRDDYTVLRYDVRGHGQTEL 62 Query: 66 PKGPYTIEQLTGDVLGLMDTLKIARANFCGLSMGGLTGVALAARHADRIERVALCNTAAR 125 K P+++ L GD+ L+D L + G+SMGG+ A H+ R++ + + ++ A Sbjct: 63 SKEPFSVGDLAGDLAALLDALGAPSTHLVGMSMGGMIAQQFALDHSSRVDSLTIADSVAA 122 Query: 126 IGSPEV---WVPRAVKARTEGMHALADAVLPRWFTADYMEREPVVLAMIRDVFVHTDKEG 182 PE W RA AR +GM LA A L RW T D+ P + I + T EG Sbjct: 123 -NPPEARATWDQRAASARRDGMAPLAAATLERWLTEDFRVAHPEAVEPIHEALTRTLPEG 181 Query: 183 YASNCEAIDAADLRPEAPGIKVPALVISGTHDLAATPAQGRELAQAIAGARYVELDASHI 242 YA CEA+ D+R + I P LV++G HD PA +E+A AI GA + LDA+H+ Sbjct: 182 YAMACEALREFDVRGKLGAIHCPTLVVAGRHDTGTRPAASQEIADAIEGAHFELLDAAHL 241 Query: 243 SNIERADAFTKTVVDFL 259 + +E++ F + FL Sbjct: 242 APVEQSQRFAALLETFL 258 Lambda K H 0.320 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 262 Length adjustment: 25 Effective length of query: 238 Effective length of database: 237 Effective search space: 56406 Effective search space used: 56406 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory