Align protocatechuate 3,4-dioxygenase type II β subunit (EC 1.13.11.3) (characterized)
to candidate H281DRAFT_01051 H281DRAFT_01051 hydroxyquinol 1,2-dioxygenase
Query= metacyc::MONOMER-14210 (241 letters) >FitnessBrowser__Burk376:H281DRAFT_01051 Length = 286 Score = 73.6 bits (179), Expect = 4e-18 Identities = 53/159 (33%), Positives = 78/159 (49%), Gaps = 31/159 (19%) Query: 55 GPIY-GHDSVQPLDNDLTKQGEGEPIGERIFVHGQVMDEDGRAIPNTLIEIWQANAAGRY 113 GP + G V +D+ GEP FV G++M +G A+PN IE+WQA++AG Y Sbjct: 102 GPFFVGGAPVHRNGDDIANGAGGEPC----FVSGRIMGLEGEAVPNARIEVWQADSAGFY 157 Query: 114 --IHALDSHPAPLDPNFYGAGRTV--TADDGTYTFTTIKPGPYPI----------MGLNN 159 + D+H A R V + DG+Y F +I PYPI L Sbjct: 158 DVQYEGDTHRA----------RAVLHSLPDGSYHFRSIVAEPYPIPHDGPVGKLLAALGR 207 Query: 160 Y-WRPAHIHLSLFGPSFLTRLVTQLYFEGDPLIQHDMIY 197 + WRPAH+H + P + RLVT ++ +GD + D ++ Sbjct: 208 HPWRPAHLHFMITAPGY-ERLVTHVFRDGDRYLDSDAVF 245 Lambda K H 0.319 0.136 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 286 Length adjustment: 25 Effective length of query: 216 Effective length of database: 261 Effective search space: 56376 Effective search space used: 56376 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory