Align protocatechuate 3,4-dioxygenase α subunit (EC 1.13.11.3) (characterized)
to candidate H281DRAFT_03864 H281DRAFT_03864 protocatechuate 3,4-dioxygenase, alpha subunit
Query= metacyc::MONOMER-3186 (201 letters) >FitnessBrowser__Burk376:H281DRAFT_03864 Length = 195 Score = 141 bits (356), Expect = 7e-39 Identities = 88/203 (43%), Positives = 120/203 (59%), Gaps = 20/203 (9%) Query: 6 LPETPSQTAGPYVHIGLALEAAGNPTRDQEIWNRLAKP-----DAPGEHILLLGQVYDGN 60 L +TPSQT GPY GL P + + L P +A GEHI ++GQV+DG+ Sbjct: 4 LKQTPSQTVGPYFAYGLC------PQQYDFDFKSLFTPVVADREAAGEHITIVGQVFDGD 57 Query: 61 GHLVRDSFLEVWQADANGEYQDAYN--LENAFNSFGRTATTFDAGE-WTLHTVKPGVVNN 117 G ++ D+ LEV Q DA+G Y ++ L+ F F R T D + + + TVKPG V+ Sbjct: 58 GKVIGDAMLEVSQVDADGHYPESREEILKKGFRGFARVGTGTDPQKRFVVETVKPGRVS- 116 Query: 118 AAGVPMAPHINISLFARGINIHLHTRLYFDDEAQANAKCPVLNLIEQPQRRETLIAKRCE 177 APH+N+ + RG+ +H TR+YF+DEAQAN + PVL + RRETLIA+R E Sbjct: 117 ---PDEAPHLNVIVTMRGMLLHTFTRIYFEDEAQANERDPVLTAV-PADRRETLIARR-E 171 Query: 178 VDGKTAYRFDIRIQGEGETVFFD 200 + YRFDI +QG+ ETVFFD Sbjct: 172 PNTANVYRFDIYMQGDKETVFFD 194 Lambda K H 0.319 0.137 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 195 Length adjustment: 20 Effective length of query: 181 Effective length of database: 175 Effective search space: 31675 Effective search space used: 31675 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory