GapMind for catabolism of small carbon sources

 

Aligments for a candidate for praB in Paraburkholderia bryophila 376MFSha3.1

Align 2-aminomuconic semialdehyde dehydrogenase; Aldehyde dehydrogenase 12; Aldehyde dehydrogenase family 8 member A1; EC 1.2.1.32 (characterized)
to candidate H281DRAFT_03256 H281DRAFT_03256 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase

Query= SwissProt::Q9H2A2
         (487 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_03256 H281DRAFT_03256
           5-carboxymethyl-2-hydroxymuconate semialdehyde
           dehydrogenase
          Length = 485

 Score =  406 bits (1044), Expect = e-118
 Identities = 207/486 (42%), Positives = 306/486 (62%), Gaps = 21/486 (4%)

Query: 8   LMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPSWSSRSPQ 67
           + +E+ I+GK      Y ++ +P+T EV   V    + E++AAV+AA+EAFP+W+ +   
Sbjct: 1   MRIEHLINGKAGGAKDYFETVNPATQEVLAEVARGTEAEVDAAVRAAKEAFPAWAGKPAA 60

Query: 68  ERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASSSLHHTSE 127
           ER++++ ++ +L+ +++ E ++ E+KD G+T++  R   +PR+  NF +FA         
Sbjct: 61  ERAKLIRKLGELIAKNVPEISETETKDTGQTISQTRKQLVPRAADNFSYFAEM------- 113

Query: 128 CTQMD--------HLGCMHYTVRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKP 179
           CT++D        HL   +YT+  PVGV  LISPWN+P    TWK+AP +A GNT + K 
Sbjct: 114 CTRVDGHTYPTDTHL---NYTLFHPVGVCALISPWNVPFMTATWKVAPCLAFGNTAVLKM 170

Query: 180 SELTSVTAWMLCKLLDKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERI 239
           SEL+ +TA ML  L  +AG+P GV+N+V G G   GE LV+HP+V  +SFTGS  T  RI
Sbjct: 171 SELSPLTASMLGNLALEAGIPAGVLNVVHGFGKETGEPLVAHPDVHAVSFTGSTATGNRI 230

Query: 240 TQLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSFANQGEICLCTSRIFVQKSI 299
            Q +    KK S+ELGGK+P +IF+DA+ +  + A V   F+N GE C   SRI VQKSI
Sbjct: 231 VQSAG--LKKYSMELGGKSPFVIFDDADFERALDAAVFMIFSNNGERCTAGSRILVQKSI 288

Query: 300 YSEFLKRFVEATRKWKVGIPSDPLVSIGALISKAHLEKVRSYVKRALAEGAQIWCGEGVD 359
           Y++F +RF+E  ++  VG P      IG +IS+ HL KVRSY++    EGA + CG G+D
Sbjct: 289 YAKFAERFIERAKRLTVGDPLADSTIIGPMISQGHLAKVRSYIELGPKEGATLACG-GLD 347

Query: 360 KLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGL 419
              LP   + G F++PTV  D+ +      EEIFGPV C++PFD E + I  AN++ YGL
Sbjct: 348 MPGLPDSMRHGNFVMPTVFVDVDNRMRIAQEEIFGPVACLIPFDDEADAIRLANDISYGL 407

Query: 420 AATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTE 479
           ++ +W+ N GR HRVA  +++G+ + N   +R+L  PFGG K+SG+GREG   SY+ F E
Sbjct: 408 SSYIWTENTGRAHRVAASVEAGMCFVNSQNVRDLRQPFGGTKASGVGREGGTWSYEVFLE 467

Query: 480 IKTITV 485
            K + V
Sbjct: 468 PKNVCV 473


Lambda     K      H
   0.319    0.133    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 596
Number of extensions: 15
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 487
Length of database: 485
Length adjustment: 34
Effective length of query: 453
Effective length of database: 451
Effective search space:   204303
Effective search space used:   204303
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory