Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate H281DRAFT_01410 H281DRAFT_01410 phosphate acetyltransferase
Query= curated2:Q9X448 (316 letters) >FitnessBrowser__Burk376:H281DRAFT_01410 Length = 311 Score = 379 bits (972), Expect = e-110 Identities = 197/299 (65%), Positives = 235/299 (78%) Query: 11 KYDRLIAAARAEAPAVTIVAHPCDETSLGGAIEAAEMGLITPILVAPEAKIRNVAAEHRL 70 KY RLIA +++ P T VAHPCD SL GA+EAA+MGLI P+LV P +I VA E L Sbjct: 7 KYQRLIAFCQSQPPLTTAVAHPCDRASLEGAVEAAQMGLIAPLLVGPRERISAVAEECGL 66 Query: 71 DLGRREIVDVPHSHAAAAKAVALIREGRGELLMKGSLHTDELMHEVAASATGLRTQRRIS 130 + ++DVPHSHAAAAKAV L+REG+ E +MKGSLHTDELM V GLRT+RR+S Sbjct: 67 QIAGYPLIDVPHSHAAAAKAVELVREGKAEAIMKGSLHTDELMAAVVHREGGLRTERRVS 126 Query: 131 HVFVMDVPGHTDTLFITDAAINIFPDLEAKRDIVQNAIDLWVAIGLGEPRVAILSAVETV 190 H FVMDVPGH + L ITDAAINI P L K DI+QNAIDL A+ + E RVAILSA+E V Sbjct: 127 HCFVMDVPGHANALIITDAAINIAPTLAEKTDILQNAIDLGHALRVDEVRVAILSAMEIV 186 Query: 191 TAKIPSTIEAAALCKMAERGQITGGVLEGPLAFDNAIDQEAARIKGINSPVAGHAQILVV 250 K+PSTIEAAALCKM +R QITG +++GPLA DNAID EAAR+K I+SPVAG A +L+V Sbjct: 187 NPKVPSTIEAAALCKMVDRHQITGALVDGPLALDNAIDLEAARMKKIDSPVAGRANVLMV 246 Query: 251 PDLEAGNMLAKNLTFLTHADAAGLVLGARVPIVLTSRADSVRTRLASCAVAALYAARRR 309 P+LEAGNMLAK+L+FL ADAAG+VLGARVPI+LTSRADS+ TRLASCAVA+L A++ R Sbjct: 247 PNLEAGNMLAKSLSFLAGADAAGIVLGARVPIILTSRADSIITRLASCAVASLVASKGR 305 Lambda K H 0.320 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 311 Length adjustment: 27 Effective length of query: 289 Effective length of database: 284 Effective search space: 82076 Effective search space used: 82076 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory