Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate H281DRAFT_02383 H281DRAFT_02383 amino acid/amide ABC transporter membrane protein 2, HAAT family /amino acid/amide ABC transporter ATP-binding protein 1, HAAT family
Query= uniprot:G8ALJ0 (294 letters) >FitnessBrowser__Burk376:H281DRAFT_02383 Length = 594 Score = 187 bits (475), Expect = 5e-52 Identities = 116/263 (44%), Positives = 156/263 (59%), Gaps = 16/263 (6%) Query: 11 LLTVEHLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGFYTPTVGRLTL 70 LLTV +FGGLVAVNDVSF G+I +IGPNGAGK+T FN +TG T G +T Sbjct: 346 LLTVNKARKQFGGLVAVNDVSFEVKAGQIIGLIGPNGAGKSTTFNLVTGVLQATSGEITF 405 Query: 71 RHADGKEFLLERMPGY--RISQKASVARTFQNIRLFGGMSVLENLIVAQHNKLIRASGFS 128 R ER+ R K + RTFQ+++L GM+VLEN+ + H + S Sbjct: 406 RG--------ERIDALSSREIVKRGIGRTFQHVKLLPGMTVLENVAIGAHLRGHAGVWRS 457 Query: 129 IAGLLGLPSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIARAMCTEPV 188 I L + E + A + RV L + EAG+L G QR LEIARA+C +P Sbjct: 458 IVRLNSV-----EEARLMAEAARQIRRVGLEQHMYDEAGSLALGQQRILEIARALCCDPT 512 Query: 189 MLCLDEPAAGLNPRESGELADLLTYIRDEHKIGVLLIEHDMSVVMTISDHVVVLDYGRKI 248 +L LDEPAAGL +E +LADLL ++ E + VLL+EHDM VM ++D +VV+++G +I Sbjct: 513 LLLLDEPAAGLRYQEKLQLADLLRRLKAE-GMSVLLVEHDMDFVMNLTDRLVVMEFGTRI 571 Query: 249 SDGDPAFVKNDPAVIRAYLGEEE 271 ++G P V+ DPAV+ AYLG E Sbjct: 572 AEGLPQEVQQDPAVLEAYLGGVE 594 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 388 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 594 Length adjustment: 31 Effective length of query: 263 Effective length of database: 563 Effective search space: 148069 Effective search space used: 148069 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory