Align L-lactate dehydrogenase; EC 1.1.1.27 (uncharacterized)
to candidate H281DRAFT_05436 H281DRAFT_05436 Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family
Query= curated2:Q07251 (349 letters) >FitnessBrowser__Burk376:H281DRAFT_05436 Length = 330 Score = 139 bits (351), Expect = 8e-38 Identities = 98/327 (29%), Positives = 164/327 (50%), Gaps = 14/327 (4%) Query: 29 VAEHLVESDRCGYISHGLSILPNYRTALDGHSVNPQGRAKCVLDQGTLMVFDGDGGFGQH 88 VA LV+ D G+ +HGL++LP Y ++ ++ G + V D+G +++DG G Sbjct: 9 VARTLVDGDLMGHDTHGLALLPAYIGEIENGAMTCSGEPEVVSDRGGSVLWDGRRLPGPW 68 Query: 89 VGKSVMQAAIERVRQHGHCIVTLRRSHHLGRMGHYGEMAAAAGF-VLLSFTNVINRAPVV 147 + S ++ R +++G + +RRSHH+ + Y E A A GF +LLS ++ ++ V Sbjct: 69 LVLSGIETLAPRAKKYGTATLVIRRSHHIACLASYLERATADGFMILLSSSDPAGQS--V 126 Query: 148 APFGGRVARLTTNPLCFAGPMPNGRPPLVVDIATSAIAINKARVLAEKGEPAPEGSIIGA 207 AP GG + T NP+ A +P P ++DI++S + + G+ E + A Sbjct: 127 APHGGTRSVFTPNPI--AAGIPTSGSPFLIDISSSMVTQGMTARRHKAGQHFEEACFLDA 184 Query: 208 DGNPTTDASTMFGEHPGALLPF----GGHKGYALGVVAELLAGVLSGGGTIQPDNPRGGV 263 DG P+ D S + + PG++LP GGHKG+ L ++ E L G L+G G P + GG Sbjct: 185 DGQPSGDPSVLCTDPPGSILPIGGMTGGHKGFGLALLIEALTGGLAGHGRADPADGWGG- 243 Query: 264 ATNNLFAVLLNPALDLGLDWQSAEVEAFVRYLHDTPPAPGVDRVQYPGEYEA-ANRAQAS 322 +F L + A GL +++ + PP PG V+ PG+ R Q Sbjct: 244 ---TVFLSLYDTAAFGGLAAFVRQMDWLGDACRNNPPRPGTAGVRMPGDRGLNLKREQLR 300 Query: 323 DTLNINPAIWRNLERLAQSLNVAVPTA 349 D + ++ I LE A+ ++ +P+A Sbjct: 301 DGVALHSTIAPALEACARRYDIPLPSA 327 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 349 Length of database: 330 Length adjustment: 28 Effective length of query: 321 Effective length of database: 302 Effective search space: 96942 Effective search space used: 96942 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory