Align LUD_dom domain-containing protein (characterized, see rationale)
to candidate H281DRAFT_04331 H281DRAFT_04331 L-lactate dehydrogenase complex protein LldG
Query= uniprot:A0A0C4YFN9 (234 letters) >FitnessBrowser__Burk376:H281DRAFT_04331 Length = 220 Score = 68.6 bits (166), Expect = 1e-16 Identities = 74/235 (31%), Positives = 104/235 (44%), Gaps = 23/235 (9%) Query: 1 MSTLSARERMLGRLRAAAPATTADASQLDARIDAHYDARREAAT----PAELA-QAMQAA 55 M T AR ML R+RAA + S + A Y AR + PA+L + ++ A Sbjct: 1 MDTSIARRNMLARIRAAQ-GREPEPSPSEREAAADYLARHPSGPRPDMPADLTGRFIEEA 59 Query: 56 LGASHALAWCASAEAWPAQLAGKLAAAGVRRLLLDPAAEQGAALMRALPASVAPLSYARP 115 + + AS PA LA L L A +R A +A Sbjct: 60 QKMATTVDTVASLSDVPAAAYRYLAD---HALPLQAIAWGTLQDLRWNDAGLA------- 109 Query: 116 IEAWKAELFDTVDAGFTVARSGIAATGTLVLAPDAQTPRTVSLVPPLHIALVYAETL--- 172 +E K + D V G T A TG+LVL T + L+P HIA+V A + Sbjct: 110 VEFRKPKDGDVV--GLTGCFCATAETGSLVLLSGPDTYASAGLLPETHIAIVPASRIVAG 167 Query: 173 HPDLHCAARAERWSAGMPTNLVLVSGPSKTSDIQQTLAYGAHGPRELWVIIVTGS 227 H + R+ER +P + +SGPS+T DI+QT+ GAHGP + VI+V G+ Sbjct: 168 HEEAFVLIRSERGE--LPRAVNFISGPSRTGDIEQTIVLGAHGPYRVHVIVVLGA 220 Lambda K H 0.317 0.127 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 234 Length of database: 220 Length adjustment: 22 Effective length of query: 212 Effective length of database: 198 Effective search space: 41976 Effective search space used: 41976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory