Align N-acetylglucosamine kinase (EC 2.7.1.59) (characterized)
to candidate H281DRAFT_05731 H281DRAFT_05731 glucosamine kinase
Query= reanno::MR1:202608 (300 letters) >FitnessBrowser__Burk376:H281DRAFT_05731 Length = 296 Score = 130 bits (326), Expect = 5e-35 Identities = 92/290 (31%), Positives = 137/290 (47%), Gaps = 5/290 (1%) Query: 7 NDQQLFIGVDGGGSKCRATIYTADGTVLGTGVAGRANPLHGLAQTFESIEASAHQALLDA 66 N+ IGVDGGG+ R + A G L +G + G+ + +++I A A A Sbjct: 2 NEDLFLIGVDGGGTGTRIVLADAHGRELAQAASGPSGLGLGVERAWQAIAAGCADAFAQA 61 Query: 67 GMKATDSHLLVAGLGLAGVNVPRLYQDVVNWQHPFAAMYVTTDLHTACIGAHRGADGAVI 126 G A D V G GLAGVN + A + V +D +T +GAH A G ++ Sbjct: 62 GA-ALDWSRCVLGCGLAGVNNRDWLAAFLAQAPALAGLAVESDAYTTLLGAHGSAYGVIV 120 Query: 127 ITGTGSCGYAHVGDAS--LSIGGHGFALGDKGSGAWLGLKAAEHVLLALDGFATPTALTE 184 GTGS A D ++ G+GF GD+ SGAWLG++A H ALDG L + Sbjct: 121 ALGTGSVAAAADRDDGEFRTVSGYGFPSGDEASGAWLGVRAIVHAQHALDGRGPNDDLAQ 180 Query: 185 MLLSHLGVKDALGIVEHLAGKSSSCYAQLARNVLDCANAGDQVAIAIVQEGADYISEMAR 244 LL+H+G D +V L + + YA LAR V+ A+ A ++ E I +M Sbjct: 181 ALLAHVGAHDRDELVVWLCEANQTAYASLARIVI--AHRAHPFAARLLGEAGLQIGKMIA 238 Query: 245 KLFMLNPVRFSMIGGLAEPLQAWLGSDVVAKISETLAPPELGAMYYAQQQ 294 L + ++ GGL PL+ ++ ++ E L+ G + AQ+Q Sbjct: 239 ALDPSGALPIALCGGLGAPLREYVPQIYQGRLREPLSDSAHGGLQLAQRQ 288 Lambda K H 0.319 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 296 Length adjustment: 26 Effective length of query: 274 Effective length of database: 270 Effective search space: 73980 Effective search space used: 73980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory