Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate H281DRAFT_06395 H281DRAFT_06395 amino acid/amide ABC transporter ATP-binding protein 1, HAAT family
Query= TCDB::P21629 (255 letters) >FitnessBrowser__Burk376:H281DRAFT_06395 Length = 255 Score = 183 bits (465), Expect = 3e-51 Identities = 106/253 (41%), Positives = 151/253 (59%), Gaps = 6/253 (2%) Query: 1 MSRPILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGG 60 MS IL SGL R+G A++ VNL + + V S+IGPNGAGKTT+F+ LTG T G Sbjct: 1 MSEAILNASGLVKRYGKFTALSEVNLSIMPRTVHSVIGPNGAGKTTLFHVLTGTLPITAG 60 Query: 61 LIRLDGEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKT 120 I DG ++ P HK R+GV R+FQ LF ++ ENL +A + +++ + Sbjct: 61 TIVFDGHDVTHEPDHKRVRRGVARSFQVTSLFANLSVQENLRLAA-QGVDSVRALNAWSP 119 Query: 121 PAFRRSEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDEP 180 P + E ++ LE + L F+ SAG L++GQQRRLE+ + RP+ + LDEP Sbjct: 120 PRGALAHTETVD---DILERLALQRFSKVSAGALSHGQQRRLEVGMALAARPKAIFLDEP 176 Query: 181 AAGLNPKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQ 240 +G+ + DD+K LI LR ++ TV+LIEH+M +VM ISD I V+ QG L +G P++ Sbjct: 177 TSGMGIDDLDDMKQLIRGLREDY--TVVLIEHNMGIVMDISDTITVMQQGRVLVEGRPDE 234 Query: 241 IRDNPDVIKAYLG 253 IR + V AYLG Sbjct: 235 IRGDERVRSAYLG 247 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 255 Length adjustment: 24 Effective length of query: 231 Effective length of database: 231 Effective search space: 53361 Effective search space used: 53361 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory