Align Inner-membrane translocator (characterized, see rationale)
to candidate H281DRAFT_02703 H281DRAFT_02703 monosaccharide ABC transporter membrane protein, CUT2 family
Query= uniprot:A0KWY7 (320 letters) >FitnessBrowser__Burk376:H281DRAFT_02703 Length = 333 Score = 166 bits (421), Expect = 6e-46 Identities = 105/292 (35%), Positives = 162/292 (55%), Gaps = 11/292 (3%) Query: 30 FASGRVVTNLLRDNAFLLITALGMTLVIISGGIDLSVGAVIALSGVVTSLLITEYQWHPL 89 F + +TN++ + + I A+G T VII+ GIDLSVG+++AL+G+V + ++ + Sbjct: 47 FLTTSTLTNIMVQVSVVGIAAVGGTFVIITSGIDLSVGSLVALTGMVAATVMAGSSPGAI 106 Query: 90 ----LAFVVILPLGTLFGALMGTIIHVYKLQPFIVTLAGMFLARGLATTLSEESIAIDHP 145 L +G GAL G + +L PFIVTLA M +ARGL +S+ D P Sbjct: 107 GLGIAGLCAALAVGAAAGALNGLAVAWLRLVPFIVTLAMMAMARGLTLAISDGRTKFDFP 166 Query: 146 -FYDAVAEMSIALPGNGALDLSSLIFILFFVIIAVVMHYTRFGTNVYAIGGNQHSAELMG 204 + A ++A L + ++ ++ FVI V++ T FG V+A+GGNQ +A L G Sbjct: 167 NAFTAFGAKTVA-----GLPMPMIVMLVIFVIGHVLLRKTTFGHQVFAVGGNQEAARLAG 221 Query: 205 ISIAKTTISIYAISSFLATLAGIVFTFYTFSGYALGAIGVELDAIAAVVIGGTLLTGGSG 264 I + + Y ++ A +AGIV S A G+EL IAAVVIGGT L GG G Sbjct: 222 IPVHRVVFLTYMLAGVTAAIAGIVLAGRLNSALPSAANGLELQVIAAVVIGGTSLAGGRG 281 Query: 265 FVLGTVLGVILMGVIQTYITFDGSLSSWWTKIVIGLLLFFFILLQKLLNGRK 316 ++GT +GV+L+GVI ++ G ++ +WT+ + G ++F +LL L RK Sbjct: 282 SIVGTFIGVVLIGVINVGLSLLG-VNPFWTQFIQGGVIFAAVLLDALSQRRK 332 Lambda K H 0.330 0.145 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 333 Length adjustment: 28 Effective length of query: 292 Effective length of database: 305 Effective search space: 89060 Effective search space used: 89060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory