Align D-xylonate dehydratase subunit (EC 4.2.1.25; EC 4.2.1.82) (characterized)
to candidate H281DRAFT_00974 H281DRAFT_00974 L-alanine-DL-glutamate epimerase
Query= metacyc::MONOMER-18070 (393 letters) >FitnessBrowser__Burk376:H281DRAFT_00974 Length = 405 Score = 204 bits (520), Expect = 3e-57 Identities = 128/353 (36%), Positives = 191/353 (54%), Gaps = 13/353 (3%) Query: 26 VLVRVTTNDGRVGWGETVSA-LRAEAVANFVKKI-NTVLKGNDVFNVEKNRLEWYKHDFN 83 + V++ T+ G G GE SA +A+ + V + + L +D +VE+ E Y F Sbjct: 24 IFVKLKTDCGIEGVGEIYSATFHPKAMTHIVDDVFSRYLLDHDPHHVERLWREAYSSGFT 83 Query: 84 MTISLESTTAYSAVDIASWDIIGKELGAPLYKLLGGKTRDKVLVYANGWYQNCVKPEDF- 142 L S +++A WDIIGK G P+Y+LLGG ++ Y + +N D+ Sbjct: 84 QRPDLTMMGVVSGLEMACWDIIGKAAGKPVYELLGGMVNPRLRSYTYLYPKNNRGEYDYD 143 Query: 143 -----AEKAKEIVKMGYKALKFDPFGPYF----NDISKKGLDIAEERVKAVREAVGDNVD 193 AE A E VK G+ A+KFDP GPY + +S + LD E + VREAVG D Sbjct: 144 DPDLAAECAAENVKRGFTAVKFDPAGPYTAYSGHQLSMEVLDRCETFCRRVREAVGSKAD 203 Query: 194 ILIEHHGRFNANSAIMIAKRLEKYNPLFMEEPIHPEDVEGLRKYRNNTSLRIALGERIIN 253 +L HG+ +SAI +AKRLEKY+PL+ EEP+ P + + + +TS+ +A GER+ Sbjct: 204 LLFGTHGQMVPSSAIRLAKRLEKYDPLWFEEPVPPGQEDAMAQVARHTSIPVAAGERLTT 263 Query: 254 KQQALYFMKEGLVDFLQADLYRIGGVTETKKVVGIAETFDVQMAFHNAQGPILNAVTLQF 313 K + ++ G LQ ++ R+GG+ E KKV +AE + Q+A H GPI A ++Q Sbjct: 264 KYEFFKLLQAGAASILQLNVARVGGLLEAKKVAALAEVYYAQIAPHLYNGPIGAAASIQL 323 Query: 314 DAFIPNFLIQESFYDWFPSWKRELIYNGTPIDNGYAIIPERPGLGVEVNEKML 366 A PNFLIQES W + ++ ++GY I PGLGVE+N +++ Sbjct: 324 AACTPNFLIQESIGTW-DGFHAAVLKKPLQWEDGYIIPSREPGLGVELNMEVV 375 Lambda K H 0.319 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 405 Length adjustment: 31 Effective length of query: 362 Effective length of database: 374 Effective search space: 135388 Effective search space used: 135388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory