Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate H281DRAFT_03224 H281DRAFT_03224 mannose ABC transporter ATP-binding protein /fructose ABC transporter ATP-binding protein /ribose ABC transporter ATP-binding protein
Query= uniprot:P0DTT6 (251 letters) >FitnessBrowser__Burk376:H281DRAFT_03224 Length = 265 Score = 204 bits (518), Expect = 2e-57 Identities = 109/242 (45%), Positives = 161/242 (66%), Gaps = 7/242 (2%) Query: 4 LLEIRDVHKSFGAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGDLVF 63 +L+ R + K +G V ALDG E+ GE++A++GDNGAGKS+LIK +SG PD G+++ Sbjct: 13 VLQARGLVKRYGNVTALDGCDFEVLPGEILAVIGDNGAGKSSLIKALSGATVPDEGEILL 72 Query: 64 EGKKVIFNSPNDARSLGIETIYQDLALIPDLPIYYNIFLAREVT-----NKIF--LNKKK 116 +GK V F SP DAR+ GIET+YQ+LA+ P + I N+FLARE+ IF ++K++ Sbjct: 73 DGKPVKFRSPLDARAQGIETVYQELAVAPAMSIAENLFLARELVKPGWRGSIFKMIDKRR 132 Query: 117 MMEESKKLLDSLQIRIPDINMKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAALSVVE 176 M+EE+ + LQI I + VE LSGGQRQ VAVAR+ F+ ++++DEPTAAL V E Sbjct: 133 MLEEATAHMKDLQIGIRSMRQAVETLSGGQRQGVAVARSAAFARHVVILDEPTAALGVKE 192 Query: 177 ARKVLELARNLKKKGLGVLIITHNIIQGYEVADRIYVLDRGKIIFHKKKEETNVEEITEV 236 VLEL R ++ +GL V++I+HN+ +EVADRI++ G+ ++ ++ E + Sbjct: 193 GNMVLELIRRVRDRGLPVILISHNMPHVFEVADRIHIQRLGRRAALVNTKDVHMSEAVAI 252 Query: 237 MT 238 MT Sbjct: 253 MT 254 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 265 Length adjustment: 24 Effective length of query: 227 Effective length of database: 241 Effective search space: 54707 Effective search space used: 54707 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory