Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate H281DRAFT_04679 H281DRAFT_04679 pyrroline-5-carboxylate reductase
Query= SwissProt::P22008 (273 letters) >FitnessBrowser__Burk376:H281DRAFT_04679 Length = 271 Score = 226 bits (576), Expect = 4e-64 Identities = 122/269 (45%), Positives = 168/269 (62%) Query: 5 RIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEAVADA 64 +IAFIG GNMAA+LIGGL +GV + A DP + R + +F I+ + A+ Sbjct: 2 KIAFIGGGNMAAALIGGLIKRGVAPTDLYAIDPNEDARKRNEEQFGINTGAAADAALTAY 61 Query: 65 DVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCASLEAWLGQPRPVVRCMPNTPA 124 D VVL+VKPQ +K+V ++LAP LK QL +SI AGI + WL +VR MPNTPA Sbjct: 62 DAVVLAVKPQILKSVAESLAPHLKASQLAISIVAGIRMDDMSRWLNGHTRIVRVMPNTPA 121 Query: 125 LLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAYFFLLM 184 L+ G +GL A A V A A Q+L AVG +W DDEA+IDAVTA+SGSGPAY F + Sbjct: 122 LIGMGVAGLAATASVDEAGRALASQVLGAVGETVWFDDEAKIDAVTAISGSGPAYVFYFI 181 Query: 185 QAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEAAIKSF 244 +A+ +A +LG++ L + T GAAQ+A +S+ P+ LR RVTS GTT AA+ SF Sbjct: 182 EALQEAARQLGMNEAQGRALAVATFTGAAQLAANSDEPPSLLRERVTSKGGTTAAALASF 241 Query: 245 QANGFEALVEQALNAASQRSAELAEQLGQ 273 A+G + + + AA R+ E+ ++ G+ Sbjct: 242 DASGVKEAIVRGALAADARAKEMGDEFGK 270 Lambda K H 0.315 0.127 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 271 Length adjustment: 25 Effective length of query: 248 Effective length of database: 246 Effective search space: 61008 Effective search space used: 61008 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate H281DRAFT_04679 H281DRAFT_04679 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00112.hmm # target sequence database: /tmp/gapView.4984.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00112 [M=263] Accession: TIGR00112 Description: proC: pyrroline-5-carboxylate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-81 258.8 6.5 3.6e-81 258.6 6.5 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_04679 H281DRAFT_04679 pyrroline-5-carb Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_04679 H281DRAFT_04679 pyrroline-5-carboxylate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 258.6 6.5 3.6e-81 3.6e-81 1 263 [] 3 264 .. 3 264 .. 0.98 Alignments for each domain: == domain 1 score: 258.6 bits; conditional E-value: 3.6e-81 TIGR00112 1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvlla 66 ia+iG+Gnm++al+ gl+k+g++ +++++ i+++e++++++ +++g+++ ++a++a ++ d v+la lcl|FitnessBrowser__Burk376:H281DRAFT_04679 3 IAFIGGGNMAAALIGGLIKRGVA-PTDLYAIDPNEDARKRNEEQFGINTGAAADAALTAYDAVVLA 67 89*****************9887.9***************************************** PP TIGR00112 67 vKPqdleevlaelkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaa 132 vKPq l++v+++l+ + ++++l iSi+AG+++++++++l++++r+vRvmPNt+a +g gv+++aa lcl|FitnessBrowser__Burk376:H281DRAFT_04679 68 VKPQILKSVAESLAP-HLKASQLAISIVAGIRMDDMSRWLNGHTRIVRVMPNTPALIGMGVAGLAA 132 **************9.66699********************************************* PP TIGR00112 133 ssevseeqkelveellkavGkvveve.eklldavtalsGSgPAfvflliealadagvklGLpreea 197 ++ v+e+ ++l++++l avG++v+ + e+++davta+sGSgPA+vf++ieal++a+ +lG+++++ lcl|FitnessBrowser__Burk376:H281DRAFT_04679 133 TASVDEAGRALASQVLGAVGETVWFDdEAKIDAVTAISGSGPAYVFYFIEALQEAARQLGMNEAQG 198 ****************************************************************** PP TIGR00112 198 kelaaqtlkGaaklleesgehpalLkdkVtsPgGtTiaglavLeekgvrsavieaveaavkrseeL 263 ++la +t+ Gaa+l ++s+e p+lL+++Vts+gGtT+a+la++ ++gv++a+ ++ aa +r++e+ lcl|FitnessBrowser__Burk376:H281DRAFT_04679 199 RALAVATFTGAAQLAANSDEPPSLLRERVTSKGGTTAAALASFDASGVKEAIVRGALAADARAKEM 264 **************************************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (271 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.81 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory