Align N-carbamoylputrescine amidase; EC 3.5.1.53 (characterized)
to candidate H281DRAFT_05434 H281DRAFT_05434 Predicted amidohydrolase
Query= SwissProt::Q9XGI9 (300 letters) >FitnessBrowser__Burk376:H281DRAFT_05434 Length = 298 Score = 114 bits (286), Expect = 2e-30 Identities = 87/276 (31%), Positives = 134/276 (48%), Gaps = 27/276 (9%) Query: 24 NVATAERLVRAAHQKGANIILIQELFE-GYYFCQAQKEEFFHRAKPYPGHPTIVRMQNLA 82 NVA + +L+ A + GA+++++ EL GY F + ++E F A+ P T + + A Sbjct: 33 NVARSIKLIEEAAEHGASLVVLPELANTGYVF--SDRDEAFTLAEDVPSGETALAWADAA 90 Query: 83 KELGVVIPVSFFEEANNAHYNSVAIIDADGTDLGLYRKSHIPDGPGYQEKYYFNPGDTGF 142 + LGV + E YNS ++ G +G YRK H+ + E +F PG+ G Sbjct: 91 QRLGVHVVAGIAERDRVRLYNSALLVGPSGI-VGTYRKLHLWNN----ENLFFEPGNKGV 145 Query: 143 KVFQTKYAKIGVAICWDQWFPEAARAMALQGAEVLFYPT---AIGSEPQDDGLDSRDHWR 199 VF T +I +AIC+D WFPE R A QGA+++ PT + +P D + Sbjct: 146 PVFHTPLGRIAIAICYDGWFPEVYRLAATQGADLVCVPTNWVPMQGQPADQPAMA----T 201 Query: 200 RVMQGHAGANVVPLVASNRIGKEIIETEHGNSEITFYGYSFIAGPTG-ELVAAAGDKEEA 258 + A +N + + +NRIG TE G F G S I G G L E Sbjct: 202 TLTMAAAHSNGLMVACANRIG-----TERGQ---LFVGQSLIVGGDGWPLAGPVSSDHEE 253 Query: 259 VLVAQFDLDKIKSKRH---GWGVYRDRRPDLYKVLL 291 +L A+ DL++ ++ R+ V RDRR D+Y +L Sbjct: 254 ILYAEIDLNRTRAGRNLNPFNHVLRDRRTDVYDPML 289 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 298 Length adjustment: 27 Effective length of query: 273 Effective length of database: 271 Effective search space: 73983 Effective search space used: 73983 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory