GapMind for catabolism of small carbon sources

 

Aligments for a candidate for arcB in Paraburkholderia bryophila 376MFSha3.1

Align Ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate H281DRAFT_04119 H281DRAFT_04119 ornithine carbamoyltransferase

Query= reanno::HerbieS:HSERO_RS07185
         (304 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_04119 H281DRAFT_04119
           ornithine carbamoyltransferase
          Length = 309

 Score =  456 bits (1174), Expect = e-133
 Identities = 215/303 (70%), Positives = 260/303 (85%), Gaps = 1/303 (0%)

Query: 3   IKHYLQFSDFTLDEYEYVIERSRVIKRKFKNYEPHHTLADRTLVMVFEKNSTRTRLSFEA 62
           I+HYLQF DF+LD+YEYV+ER+R++KRKFKNYE +H L DRTL M+FEKNSTRTRLSFEA
Sbjct: 6   IRHYLQFKDFSLDDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTRLSFEA 65

Query: 63  GMHQMGGAAIYLNTRDSQLGRGEPVEDAAQVMSRMCDVIMIRTYGQEIIERFAKHSRVPV 122
           G+ Q+GG A++++TRD+QLGRGEP+EDAAQV+SRM D+IMIRT+GQ+II+RFA++SRVPV
Sbjct: 66  GIFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDIIQRFAENSRVPV 125

Query: 123 INGLTNEQHPCQVLADVFTYIEHHGSIQGKIVAWVGDANNMLYSWLQAAEVFGFHVNVST 182
           INGLTNE HPCQVLAD+FTY EH G I+GK VAWVGDANNMLY+W++AA++ GF + +ST
Sbjct: 126 INGLTNEYHPCQVLADIFTYFEHRGPIRGKTVAWVGDANNMLYTWIEAAQILGFKLRLST 185

Query: 183 PKGYDIDPAQVSPGNKN-YTFFADPADACQDADLVTTDVWTSMGFEAENNARLKAFDGWI 241
           P GY +D A V+  +   +  F DP +AC  ADLVTTDVWTSMGFEAEN AR KAF  W 
Sbjct: 186 PPGYKLDRALVAAESAPFFQEFDDPNEACAGADLVTTDVWTSMGFEAENEARKKAFADWC 245

Query: 242 VDQAKMARAKKDALFMHCLPAHRGEEVAAEVIDGPQSVVWEEAENRLHVQKALLEYLVHG 301
           VD   M+RA  DALFMHCLPAHRGEEV+AEVIDGPQSVVW+EAENRLHVQKAL+EYL+ G
Sbjct: 246 VDAEMMSRANADALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKALMEYLLLG 305

Query: 302 RFD 304
           + +
Sbjct: 306 KLN 308


Lambda     K      H
   0.321    0.135    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 377
Number of extensions: 14
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 304
Length of database: 309
Length adjustment: 27
Effective length of query: 277
Effective length of database: 282
Effective search space:    78114
Effective search space used:    78114
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

Align candidate H281DRAFT_04119 H281DRAFT_04119 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00658.hmm
# target sequence database:        /tmp/gapView.1175.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00658  [M=304]
Accession:   TIGR00658
Description: orni_carb_tr: ornithine carbamoyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
   5.8e-112  359.7   0.0   6.8e-112  359.5   0.0    1.0  1  lcl|FitnessBrowser__Burk376:H281DRAFT_04119  H281DRAFT_04119 ornithine carbam


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Burk376:H281DRAFT_04119  H281DRAFT_04119 ornithine carbamoyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  359.5   0.0  6.8e-112  6.8e-112       1     303 [.       7     303 ..       7     304 .. 0.98

  Alignments for each domain:
  == domain 1  score: 359.5 bits;  conditional E-value: 6.8e-112
                                    TIGR00658   1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGa 66 
                                                  rh+l+++d+s ++ +++le+a+ lk++ k+ ++ + l+ +tla+iFek+stRtR+sfe+++++lG+
  lcl|FitnessBrowser__Burk376:H281DRAFT_04119   7 RHYLQFKDFSLDDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTRLSFEAGIFQLGG 72 
                                                  89*****************************9********************************** PP

                                    TIGR00658  67 qvlylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqi 132
                                                  +++++++ ++qlgr+e+i+D a+v+sr+vd+i++R++ +++++ +a+++ vPvingLt++ hPcq+
  lcl|FitnessBrowser__Burk376:H281DRAFT_04119  73 HAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDIIQRFAENSRVPVINGLTNEYHPCQV 138
                                                  ****************************************************************** PP

                                    TIGR00658 133 laDlltikeklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiak 198
                                                  laD++t  e+ g + + ++++vGDann+  + + aa  lG++++++tP+g++ + ++v      a+
  lcl|FitnessBrowser__Burk376:H281DRAFT_04119 139 LADIFTYFEHRGPIRGKTVAWVGDANNMLYTWIEAAQILGFKLRLSTPPGYKLDRALV------AA 198
                                                  *****************************************************99987......45 PP

                                    TIGR00658 199 enggkleltedpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCL 264
                                                  e+   ++  +dp++a ++ad++ tDvw+smG e+++e+r k++ ++ v+ e+++ a+ ++ f+hCL
  lcl|FitnessBrowser__Burk376:H281DRAFT_04119 199 ESAPFFQEFDDPNEACAGADLVTTDVWTSMGFEAENEARKKAFADWCVDAEMMSRANADALFMHCL 264
                                                  677889999********************************************************* PP

                                    TIGR00658 265 PavrGeevtdevlegeasivfdeaenRlhaqkavlkall 303
                                                  Pa+rGeev+ ev++g++s+v+deaenRlh+qka++++ll
  lcl|FitnessBrowser__Burk376:H281DRAFT_04119 265 PAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKALMEYLL 303
                                                  ***********************************9987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (304 nodes)
Target sequences:                          1  (309 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 7.07
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory