Align ABC transporter for L-Arginine, periplasmic substrate-binding component (characterized)
to candidate H281DRAFT_05882 H281DRAFT_05882 amino acid ABC transporter substrate-binding protein, PAAT family
Query= reanno::BFirm:BPHYT_RS07735 (264 letters) >FitnessBrowser__Burk376:H281DRAFT_05882 Length = 262 Score = 292 bits (748), Expect = 4e-84 Identities = 141/255 (55%), Positives = 182/255 (71%) Query: 10 ALALFAAASATAGTAAAADIKEVHFGVEASYAPFESKSPSGELQGFDIDVGNAVCAKLKA 69 +L L AA +A+ T + + FG+EA+Y PFESKSP+G+LQGFD+DVGNAVCAKL Sbjct: 8 SLLLVAATAASLSTVTTQSQETLRFGIEAAYPPFESKSPTGQLQGFDVDVGNAVCAKLGM 67 Query: 70 KCVWVENSFDGLIPALQARKFNAINSDMTITDQRRQAVDFTDPIYTIPNQMIAKKGSGLL 129 KCVWVEN+FDGLIPALQARKF+ INS M IT++R+Q+++FT PIY +P M+A++ SGLL Sbjct: 68 KCVWVENAFDGLIPALQARKFDVINSAMNITEKRKQSIEFTKPIYVVPIVMVARRASGLL 127 Query: 130 PTPASLKGKHVGVLQGTIQETYAKARWAPAGVDVVPYQTQDQIYADLASGRLDAAFQDAE 189 P SL+GK VGVLQ + QE + K WAPAGV VVPY QDQ+YADL +GRLDAA Q+A+ Sbjct: 128 PDVKSLQGKRVGVLQASSQEDFLKRHWAPAGVTVVPYADQDQVYADLVAGRLDAAVQEAQ 187 Query: 190 AASKGFLKKPQGAGFEFAGPAVTDEKLLGAGVGFGVRKGDKALKDALNQALKELKADGTI 249 GFL KP G + G ++D LG G G+G+RKGDK L ++ AL LK DGT+ Sbjct: 188 TVQDGFLVKPAGHEYAIVGKPLSDPATLGEGTGWGLRKGDKVLVAKVDAALDALKKDGTL 247 Query: 250 DRFAAKYFDVKVVLK 264 + KYF ++ + Sbjct: 248 SSLSQKYFKQDIIAR 262 Lambda K H 0.317 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 262 Length adjustment: 25 Effective length of query: 239 Effective length of database: 237 Effective search space: 56643 Effective search space used: 56643 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory