Align arginine-pyruvate transaminase (EC 2.6.1.84) (characterized)
to candidate H281DRAFT_05564 H281DRAFT_05564 Aspartate/methionine/tyrosine aminotransferase
Query= BRENDA::Q9HUI9 (393 letters) >FitnessBrowser__Burk376:H281DRAFT_05564 Length = 392 Score = 187 bits (476), Expect = 3e-52 Identities = 127/370 (34%), Positives = 179/370 (48%), Gaps = 5/370 (1%) Query: 17 AWDIHYRALARVEQGEEILLLSVGDPDFDTPAPIVQAAIDSLLAGNTHYADVRGKRALRQ 76 A + RA A QG I+ LS+G+PDF P + AA +++ + Y G ALR+ Sbjct: 15 AMEFGKRAAALEAQGHHIIKLSIGEPDFGAPPAVSLAAREAMDGRSLAYTSALGIPALRE 74 Query: 77 RIAERHRRRSGQAVDAEQVVVLAGAQCALYAVVQCLLNPGDEVIVAEPMYVTYEAVFGAC 136 IA +R V + ++VV AGA AL V L++PGDEVIV +P Y + Sbjct: 75 AIAGFYREVHDVEVHSSRIVVTAGASAALLLVTAALVDPGDEVIVGDPSYPCNRQFLASF 134 Query: 137 GARVVPVPVRSENGFRVQAEEVAALITPRTRAMALNSPHNPSGASLPRATWEALAELCMA 196 GA+V VP + F++ A V A T +TR + + +P NP+G S+P EA+ Sbjct: 135 GAQVKLVPTDANTRFQLDAAAVRANWTEKTRGLMIATPSNPTGTSIPPHELEAICSWAHQ 194 Query: 197 HDLWMISDEVYSEL-LFDGEHVSPASLPGMADRTATLNSLSKSHAMTGWRVGWVVGPAAL 255 H+ W I DE+Y L D +P ++ +NS SK MTGWR+GW V P AL Sbjct: 195 HNAWRIVDEIYLNLGDHDAHGRAPQTVLSFDPDAIVINSFSKYFGMTGWRLGWCVVPDAL 254 Query: 256 CAHLENLALCMLYGSPEFIQDAACTA--LEAPLPELEAMREAYRRRRDLVIECLADSPGL 313 +E LA Y P I A A L EA R+ + RR LV+ L Sbjct: 255 VPTMERLAQ-NYYICPSTISQHAALACFTRESLALCEARRQQFAERRALVLAGLERIGLP 313 Query: 314 RPLRPDGGMFVMVDIRPTGLSAQAFADRLLDRHGVSVLAGEAFGP-SAAGHIRLGLVLGA 372 P+ PDG +V D+ TGL++ F +R L+ V++ G+ FG A +RL Sbjct: 314 VPVPPDGAFYVYFDVGHTGLTSWEFCERALEEAHVALTPGKDFGSCGAETFVRLSYAAST 373 Query: 373 EPLREACRRI 382 L EA R+ Sbjct: 374 SDLAEAIERL 383 Lambda K H 0.322 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 392 Length adjustment: 31 Effective length of query: 362 Effective length of database: 361 Effective search space: 130682 Effective search space used: 130682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory