Align Arginine N-succinyltransferase; AST; AOST; EC 2.3.1.109 (characterized)
to candidate H281DRAFT_06480 H281DRAFT_06480 arginine succinyltransferase
Query= SwissProt::P0AE37 (344 letters) >FitnessBrowser__Burk376:H281DRAFT_06480 Length = 345 Score = 320 bits (820), Expect = 3e-92 Identities = 161/340 (47%), Positives = 225/340 (66%), Gaps = 3/340 (0%) Query: 1 MMVIRPVERSDVSALMQLASKTGGGLTSLPANEATLSARIERAIKTWQGELPKSEQGYVF 60 M+V+R V+R DV ALM+LA +TG GLT+ + L+AR+ERA +T + + E GY F Sbjct: 1 MIVVRVVQRGDVDALMRLAQETGPGLTTFKPDRDALAARVERARRTMEDKAEPHEAGYFF 60 Query: 61 VLEDSETGTVAGICAIEVAVGLNDPWYNYRVGTLVHASKELNVYNALPTLFLSNDHTGSS 120 V+ED+ TG VAG+C IE AVGL P+YNYRV T+VHAS++L ++ + L +S+D TG + Sbjct: 61 VMEDTATGDVAGVCGIETAVGLQQPFYNYRVSTVVHASQDLGIWTRMRALNISHDLTGYA 120 Query: 121 ELCTLFLDPDWRKEGNGYLLSKSRFMFMAAFRDKFNDKVVAEMRGVIDEHGYSPFWQSLG 180 E+C+LFL P +R G G LLS+SRFMF+A FR++F ++ AE+RG D G SPFW+++G Sbjct: 121 EVCSLFLSPRYRTSGVGGLLSRSRFMFLAQFRERFPQRLCAELRGHFDAEGTSPFWRAVG 180 Query: 181 KRFFSMDFSRADFLCGTGQKAFIAELMPKHPIYTHFLSQEAQDVIGQVHPQTAPARAVLE 240 F+ +DF+ AD+L G+KAF+AELMP++P+Y L QEAQ+ +G H T PAR +LE Sbjct: 181 SHFYQIDFNAADYLSSHGRKAFLAELMPRYPVYVELLPQEAQECVGLTHNDTIPARRMLE 240 Query: 241 KEGFRYRNYIDIFDGGPTLECDIDRVRAIRKSRLVEVAEGQPAQG---DFPACLVANENY 297 EG RY N++DIFD GP LEC I +R +R+S LV V +G D P +V+N + Sbjct: 241 AEGLRYENHVDIFDAGPVLECHISDLRTVRESVLVPVEIADVPEGAAQDAPRSMVSNTSL 300 Query: 298 HHFRVVLVRTDPATERLILTAAQLDALKCHAGDRVRLVRL 337 FRV + P + A + AL AGD VR++ L Sbjct: 301 GDFRVGVAAGVPQDGVFRMNATEAAALGVKAGDPVRVLAL 340 Lambda K H 0.321 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 345 Length adjustment: 29 Effective length of query: 315 Effective length of database: 316 Effective search space: 99540 Effective search space used: 99540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate H281DRAFT_06480 H281DRAFT_06480 (arginine succinyltransferase)
to HMM TIGR03244 (astA: arginine N-succinyltransferase (EC 2.3.1.109))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03244.hmm # target sequence database: /tmp/gapView.13199.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03244 [M=336] Accession: TIGR03244 Description: arg_catab_AstA: arginine N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-149 482.9 0.0 2.3e-149 482.7 0.0 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_06480 H281DRAFT_06480 arginine succiny Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_06480 H281DRAFT_06480 arginine succinyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 482.7 0.0 2.3e-149 2.3e-149 1 336 [] 3 340 .. 3 340 .. 0.98 Alignments for each domain: == domain 1 score: 482.7 bits; conditional E-value: 2.3e-149 TIGR03244 1 ivrpvktsdldallelakeaGvGltslpaneellekrieraeksfageleraeegylfvledtetg 66 +vr+v++ d+dal++la+e+G Glt+++ ++++l++r+era++++++++e+ e+gy+fv+edt+tg lcl|FitnessBrowser__Burk376:H281DRAFT_06480 3 VVRVVQRGDVDALMRLAQETGPGLTTFKPDRDALAARVERARRTMEDKAEPHEAGYFFVMEDTATG 68 79**************************************************************** PP TIGR03244 67 kvvGvsaieaavGleepfynyrvgkvvhaskelniykkletlflsndltgaselCtlfldeeyrke 132 +v+Gv++ie+avGl++pfynyrv++vvhas++l+i++++ +l++s+dltg++e+C+lfl+++yr++ lcl|FitnessBrowser__Burk376:H281DRAFT_06480 69 DVAGVCGIETAVGLQQPFYNYRVSTVVHASQDLGIWTRMRALNISHDLTGYAEVCSLFLSPRYRTS 134 ****************************************************************** PP TIGR03244 133 lnGkllskarflflaefkerfskkiiaemrGvsdeeGrsPfWealgkkffsldfskadylsgiGkk 198 +G lls++rf+fla+f+erf ++++ae+rG++d eG+sPfW+a+g++f+++df++adyls++G+k lcl|FitnessBrowser__Burk376:H281DRAFT_06480 135 GVGGLLSRSRFMFLAQFRERFPQRLCAELRGHFDAEGTSPFWRAVGSHFYQIDFNAADYLSSHGRK 200 ****************************************************************** PP TIGR03244 199 afiaelmPkfPiyvdllskeaqdvigkvhektkPalalleseGlryqgyvdifdaGptleaevaki 264 af+aelmP++P+yv+ll++eaq+ +g +h++t Pa+++le+eGlry+++vdifdaGp+le++++++ lcl|FitnessBrowser__Burk376:H281DRAFT_06480 201 AFLAELMPRYPVYVELLPQEAQECVGLTHNDTIPARRMLEAEGLRYENHVDIFDAGPVLECHISDL 266 ****************************************************************** PP TIGR03244 265 ravresklvevavaes..aaedeaepylvanekledfrvvlvessldaeelvlsaeeakalkveeG 328 r+vres lv+v++a++ a ++a++++v+n++l dfrv ++ + + + ++a+ea+al v++G lcl|FitnessBrowser__Burk376:H281DRAFT_06480 267 RTVRESVLVPVEIADVpeGAAQDAPRSMVSNTSLGDFRVGVAAGVPQDGVFRMNATEAAALGVKAG 332 **********999876223456699***************************************** PP TIGR03244 329 dkvrvval 336 d vrv+al lcl|FitnessBrowser__Burk376:H281DRAFT_06480 333 DPVRVLAL 340 *****986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (336 nodes) Target sequences: 1 (345 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.89 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory