Align Succinylglutamate desuccinylase (EC 3.5.1.96) (characterized)
to candidate H281DRAFT_06483 H281DRAFT_06483 succinylglutamate desuccinylase
Query= reanno::BFirm:BPHYT_RS07720 (342 letters) >lcl|FitnessBrowser__Burk376:H281DRAFT_06483 H281DRAFT_06483 succinylglutamate desuccinylase Length = 350 Score = 592 bits (1526), Expect = e-174 Identities = 293/338 (86%), Positives = 311/338 (92%) Query: 5 LLDDFLAYTLAGTRPAASETQGTCAGGVRWSWLDDGVLLMEPAAQDESVRSVLVSAGVHG 64 +LDDFLAYTLAGTRP+A+ET GTC GGVRWSWLD+GVLLMEPAA RSVL SAGVHG Sbjct: 13 MLDDFLAYTLAGTRPSANETHGTCGGGVRWSWLDEGVLLMEPAAITADTRSVLASAGVHG 72 Query: 65 DETAPIELLGFLVRDIAQGTAALTCRLLVILGNVDAMRDACRYRDDDLNRLFSGRHLQVP 124 DETAPIELL LVRD+A+G AALTCRLLVILGNVDAMRDACRYRDDDLNRLFSGRHLQ+P Sbjct: 73 DETAPIELLSHLVRDMARGEAALTCRLLVILGNVDAMRDACRYRDDDLNRLFSGRHLQLP 132 Query: 125 QSYEAPRAAALEQAATQFFAAASNKSGARWHIDMHTAIRASAFEQFALLPHTGKPFSRAM 184 SYEAPRAAALEQAATQFFA AS + GARWHIDMHTAIRASAFE+FALLPHTG+PFSRAM Sbjct: 133 HSYEAPRAAALEQAATQFFATASRQPGARWHIDMHTAIRASAFERFALLPHTGRPFSRAM 192 Query: 185 FEWLGEARISAVLLHTTKGNTYSHFTAQVCGAEACTLELGKVRPFGQNDLTRFAGADHAV 244 FEWL EARISAVLLHTTKGNTYSHFTAQ C AEACTLELGKVRPFGQNDLTRFAGAD A+ Sbjct: 193 FEWLAEARISAVLLHTTKGNTYSHFTAQACEAEACTLELGKVRPFGQNDLTRFAGADAAL 252 Query: 245 RHLLAGMRGHVRADLPRAFTVIDQITKQSDAFELLVAADVANFTPFAKGTVLARDGEYRY 304 RHLLAG G +A+LPRAFTVIDQITK S+AFELLVA DVANFTPF KGT+LARDG+YRY Sbjct: 253 RHLLAGTSGREQAELPRAFTVIDQITKPSEAFELLVAPDVANFTPFGKGTLLARDGDYRY 312 Query: 305 VVQHDEERLVFPNATVKPGLRAGLMVVETTQDTLSKLV 342 VVQHDEERLVFPNATVKPGLRAGLMV+ETT DTL+KLV Sbjct: 313 VVQHDEERLVFPNATVKPGLRAGLMVIETTHDTLAKLV 350 Lambda K H 0.322 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 350 Length adjustment: 29 Effective length of query: 313 Effective length of database: 321 Effective search space: 100473 Effective search space used: 100473 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate H281DRAFT_06483 H281DRAFT_06483 (succinylglutamate desuccinylase)
to HMM TIGR03242 (astE: succinylglutamate desuccinylase (EC 3.5.1.96))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03242.hmm # target sequence database: /tmp/gapView.5978.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03242 [M=319] Accession: TIGR03242 Description: arg_catab_astE: succinylglutamate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-128 414.3 0.0 2e-128 414.1 0.0 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_06483 H281DRAFT_06483 succinylglutamat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_06483 H281DRAFT_06483 succinylglutamate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 414.1 0.0 2e-128 2e-128 1 318 [. 16 338 .. 16 339 .. 0.96 Alignments for each domain: == domain 1 score: 414.1 bits; conditional E-value: 2e-128 TIGR03242 1 dflaltlekkepevtqge...aknvklrwldeGvlelePe..aeaekslvisaGihGnetaPiell 61 dfla tl+ +p++++++ +v++ wldeGvl +eP+ + ++s++ saG+hG+etaPiell lcl|FitnessBrowser__Burk376:H281DRAFT_06483 16 DFLAYTLAGTRPSANETHgtcGGGVRWSWLDEGVLLMEPAaiTADTRSVLASAGVHGDETAPIELL 81 79********99776665446679****************888899******************** PP TIGR03242 62 eqllsdiaagklqlkvrlLlilGnpaalrkgkRyleedlnRlfgGryqeleeskeklRaeeLeqvv 127 ++l++d+a+g+ +l +rlL+ilGn a+r + Ry ++dlnRlf+Gr+ +l +s e+ Ra+ Leq++ lcl|FitnessBrowser__Burk376:H281DRAFT_06483 82 SHLVRDMARGEAALTCRLLVILGNVDAMRDACRYRDDDLNRLFSGRHLQLPHSYEAPRAAALEQAA 147 ****************************************************************** PP TIGR03242 128 eaffeagkasea.ryhyDlhtaiRasklekfallPyqekpfdkellewlaaadldavllhkekggt 192 ++ff++++++ r+h+D+htaiRas +e+fallP++++pf+++++ewla+a + avllh++kg+t lcl|FitnessBrowser__Burk376:H281DRAFT_06483 148 TQFFATASRQPGaRWHIDMHTAIRASAFERFALLPHTGRPFSRAMFEWLAEARISAVLLHTTKGNT 213 *****99887645***************************************************** PP TIGR03242 193 fshfssekleaeactlelGkarPfGendlsqfqaitealralisdeaiparkkeelklfevvesil 258 +shf+++++eaeactlelGk+rPfG+ndl++f+ +++alr l+++++ ++ + + ++f+v+++i+ lcl|FitnessBrowser__Burk376:H281DRAFT_06483 214 YSHFTAQACEAEACTLELGKVRPFGQNDLTRFAGADAALRHLLAGTSGREQAELP-RAFTVIDQIT 278 *******************************************998888777777.9********* PP TIGR03242 259 kksdsfelhvaedasnftefakGtllaedkderyrveeeeerilfPnakvanGlRaglll 318 k s++fel va d+ nft+f kGtlla+d d+ry+v+++eer++fPna+v+ GlRagl++ lcl|FitnessBrowser__Burk376:H281DRAFT_06483 279 KPSEAFELLVAPDVANFTPFGKGTLLARDGDYRYVVQHDEERLVFPNATVKPGLRAGLMV 338 ***********************************************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (319 nodes) Target sequences: 1 (350 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.49 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory