GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ech in Paraburkholderia bryophila 376MFSha3.1

Align 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35); short-chain-enoyl-CoA hydratase (EC 4.2.1.150) (characterized)
to candidate H281DRAFT_00916 H281DRAFT_00916 short chain enoyl-CoA hydratase /3-hydroxyacyl-CoA dehydrogenase

Query= BRENDA::A4YDS4
         (651 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_00916 H281DRAFT_00916 short
           chain enoyl-CoA hydratase /3-hydroxyacyl-CoA
           dehydrogenase
          Length = 694

 Score =  183 bits (464), Expect = 3e-50
 Identities = 127/399 (31%), Positives = 206/399 (51%), Gaps = 26/399 (6%)

Query: 2   KVTVIGSGVMGHGIAELAAIAGNEVWMNDISTEILQQAMERIKWSLSKLRESGSLK-EGV 60
           +V VIG+G MG GIA     AG  V + +   E L + +  I+ +     + G LK E +
Sbjct: 295 QVAVIGAGTMGGGIAMNFISAGIPVTLLETKQEALDRGLATIRKNYEATVKKGKLKPEAL 354

Query: 61  EQVLARIHPETDQAQALKGSDFVIEAVKEDLELKRTIFRNAEAHASPSAVLATNTSSLPI 120
           E+ +A I P T     LK +D ++EAV E+L +K  +F+  +  A   A+LA+NTS+L +
Sbjct: 355 EERMALITP-TLSYDDLKNADLIVEAVFEELGVKEQVFKRLDEVAKSGAILASNTSTLDV 413

Query: 121 SEIASVLKSPQRVVGMHFFNPPVLMPLVEIVRGKDTSDEVVKTTAEMAKSMNKETIVVKD 180
            +IA+  + PQ VVGMHFF+P  +M L+E+VRGK+T+ +V+ T  ++AK + K  +V   
Sbjct: 414 DKIAAFTRRPQDVVGMHFFSPANVMKLLEVVRGKETAKDVLATVMKLAKKIKKTAVVSGV 473

Query: 181 VPGFFVNRVLLRIMEAGCYLVEKGIASIQEVDSSAIEELGFPMGVFLLADYTGLDIGYSV 240
             GF  NR++ + +    +++++G    Q VD  AIE+ GF MG F ++D  G DIG+++
Sbjct: 474 CDGFIGNRMIEQYIRQALFMLDEGALPAQ-VD-RAIEKFGFAMGPFRMSDLAGNDIGWAI 531

Query: 241 WKAVTARGFKAFPCSSTEKLVSQGKLGVKSGSGYYQYPS------PGKFVRPTLPSTS-- 292
            K       +       ++L   G+ G K+G G+Y Y +      P K V   + + S  
Sbjct: 532 RKRRYEEHPEMHYSKIADRLCETGRFGQKTGGGWYDYKAGDRTAHPSKLVDDMIVAYSNE 591

Query: 293 -----KKLG-----RYLISPAVNEVSYLLREGIVGK-DDAEKGCVLGLGLP---KGILSY 338
                +K+G       L+   VNE + +L EGI  K  D +   + G G P    G + Y
Sbjct: 592 TNTQRRKIGDDEIVERLVFALVNEGAKILEEGIASKPSDIDMVYLTGYGFPLYRGGPMLY 651

Query: 339 ADEIGIDVVVNTLEEMRQTSGMDHYSPDPLLLSMVKEGK 377
           AD +G+  V   +         D +   P +  +  +G+
Sbjct: 652 ADTVGLYNVERAIRRYASQPNGDAWQLAPSIAELAAQGR 690



 Score =  105 bits (263), Expect = 5e-27
 Identities = 61/190 (32%), Positives = 105/190 (55%), Gaps = 6/190 (3%)

Query: 407 LAWIVLNRPTRYNAINGDMIREINQALDSLEEREDVRVIAITGQGRVFSAGADVTEFGSL 466
           +A I LN P   N +       I + ++  +    ++ I +TG G+ FS GAD+TEF + 
Sbjct: 11  VAVITLNNPP-VNGLGLSTRAGIVEGIERAQNDAAIKAIVLTGAGKAFSGGADITEFNTP 69

Query: 467 TPVKAMIASRKFHEVFMKIQFLTKPVIAVINGLALGGGMELALSADFRVASKTAEMGQPE 526
              +    +     V   ++   KPV+A I+ +A+GGG+ELAL A +R+A+  A++  PE
Sbjct: 70  KATQEPTLAT----VIKTVEGSPKPVVAAIHSVAMGGGLELALGAHYRIAAPGAQIALPE 125

Query: 527 INLGLIPGGGGTQRLSRLSG-RKGLELVLTGRRVKAEEAYRLGIVEFLAEPEELESEVRK 585
           + LG++PG GGTQRL R  G    L ++++G  V +++  R G+ + LA+ +  E+ +  
Sbjct: 126 VKLGILPGAGGTQRLPRAIGLEAALNMIVSGAPVMSQDLARSGLFDELADGDLTEAALAF 185

Query: 586 LANAIAEKSP 595
                A++ P
Sbjct: 186 ARKVGAKEGP 195


Lambda     K      H
   0.316    0.134    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 964
Number of extensions: 53
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 651
Length of database: 694
Length adjustment: 39
Effective length of query: 612
Effective length of database: 655
Effective search space:   400860
Effective search space used:   400860
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory