GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gbuA in Paraburkholderia bryophila 376MFSha3.1

Align guanidinobutyrase subunit (EC 3.5.3.7) (characterized)
to candidate H281DRAFT_00178 H281DRAFT_00178 agmatinase

Query= metacyc::MONOMER-11557
         (320 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_00178 H281DRAFT_00178
           agmatinase
          Length = 329

 Score =  478 bits (1230), Expect = e-140
 Identities = 226/310 (72%), Positives = 266/310 (85%)

Query: 11  QPLGGNEMPRFGGIATMLRLPHLQSAKGLDAAFIGVPLDIGTSLRSGTRFGPRQIRAESV 70
           QPL GN MPR GGIATM+RLP++ SA+G DA F+GVP D+GTS R+G RFGPRQIR+ESV
Sbjct: 16  QPLSGNAMPRSGGIATMMRLPNVGSAEGFDACFVGVPFDLGTSNRTGARFGPRQIRSESV 75

Query: 71  MIRPYNMATGAAPFDSLSVADIGDVAINTFNLLDAVRIIEEAYDEIVEHNVIPMTLGGDH 130
           ++RPYNMAT AAPFDSL VAD+GDVAIN +NL D++  IE AYDEI++H+  P+TLGGDH
Sbjct: 76  LLRPYNMATRAAPFDSLRVADLGDVAINPYNLHDSIARIETAYDEILQHDCKPVTLGGDH 135

Query: 131 TITLPILRALHKKHGKIGLVHIDAHADVNDHMFGEKIAHGTTFRRAVEEGLLDCDRVVQI 190
           TI LPILRA+H+KHGK+GL+H+DAHADVND M GEKIAHGT FRRAVEEGLLDC+RVVQI
Sbjct: 136 TIALPILRAIHRKHGKVGLIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLDCERVVQI 195

Query: 191 GLRAQGYTADDFNWSRRQGFRVVQAEECWHKSLEPLMAEVREKVGGGPVYLSFDIDGIDP 250
           GLR  GY A+DF+W R QGF VVQAE CW++SL PLMA VRE++G GPVY++FDIDGIDP
Sbjct: 196 GLRGTGYAAEDFDWCRDQGFDVVQAEACWNQSLAPLMARVRERMGDGPVYITFDIDGIDP 255

Query: 251 AWAPGTGTPEIGGLTTIQAMEIIRGCHGLDLIGCDLVEVSPPYDTTGNTSLLGANLLFEM 310
           A+APGTGTPEI GLT  QA+EIIRG  GL+++GCDLVEV+PPYD  G T+LL ANL FE+
Sbjct: 256 AFAPGTGTPEIAGLTVPQALEIIRGARGLNIVGCDLVEVAPPYDPFGTTALLAANLAFEL 315

Query: 311 LCVLPGVVRR 320
           LCVLPGV  R
Sbjct: 316 LCVLPGVEYR 325


Lambda     K      H
   0.322    0.141    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 437
Number of extensions: 16
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 320
Length of database: 329
Length adjustment: 28
Effective length of query: 292
Effective length of database: 301
Effective search space:    87892
Effective search space used:    87892
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory