GapMind for catabolism of small carbon sources

 

Aligments for a candidate for kauB in Paraburkholderia bryophila 376MFSha3.1

Align 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate H281DRAFT_00993 H281DRAFT_00993 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase

Query= metacyc::MONOMER-11560
         (497 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_00993 H281DRAFT_00993
           gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
          Length = 497

 Score =  531 bits (1367), Expect = e-155
 Identities = 256/495 (51%), Positives = 351/495 (70%), Gaps = 1/495 (0%)

Query: 4   LTRADWEQRAQQLKIEGRAFINGEYTDAVSGETFECLSPVDGRFLAKVASCDLADANRAV 63
           +T  +W+Q+A  L ++GRAFI G+  +A S ETF  L+P  G+ LA +A CD  D +RAV
Sbjct: 2   MTYQEWKQKADALSLDGRAFIAGQRANAASNETFATLNPSTGKVLADIAKCDTKDVDRAV 61

Query: 64  ENARATFNSGVWSQLAPAKRKAKLIRFADLLRKNVEELALLETLDMGKPIGDSSSIDIPG 123
             AR  F SGVWS+ APA+RKA L R A L+  N EELALLE L+ GKPI +   +DIP 
Sbjct: 62  AAAREAFESGVWSKAAPAQRKAVLQRLAQLIDDNAEELALLEALEAGKPISECLGLDIPE 121

Query: 124 AAQAIHWTAEAIDKVYDEVAPTPHDQLGLVTREPVGVVGAIVPWNFPLLMACWKLGPALA 183
           +A  I W AE  DK YD ++P+    + ++TREP+GVVGA++PWNFP LM  WK+GPAL+
Sbjct: 122 SAACIRWHAEVTDKRYDALSPSGASVVSMITREPIGVVGAVLPWNFPALMLAWKIGPALS 181

Query: 184 TGNSVVLKPSEKSPLTAIRIAQLAIEAGIPAGVLNVLPGYGHTVGKALALHMDVDTLVFT 243
            GNSV++KP+E++ L+ +RIA LA+EAG+PAGVLNV+ G+G + G+AL  H DVD + FT
Sbjct: 182 VGNSVIVKPAEQTSLSTLRIADLALEAGLPAGVLNVVTGFGESAGQALGRHADVDLVAFT 241

Query: 244 GSTKIAKQLMVYAGESNMKRIWLEAGGKSPNIVFADAPDLQAAAEAAASAIAFNQGEVCT 303
           GST+  K+ + Y+ ++N+KR+ LE GGK+P +V  D  +L A AE A +A  +N GE C+
Sbjct: 242 GSTETGKRFLRYSADTNLKRVVLECGGKNPQVVLPDVANLDAVAEQAVAAAFWNMGENCS 301

Query: 304 AGSRLLVERSIKDKFLPMVVEALKGWKPGNPLDPQTTVGALVDTQQMNTVLSYIEAGHKD 363
           AGSR+LV  S+K   L  V+  L+ WK G+PLDP   +G+L++      VL++IE    +
Sbjct: 302 AGSRILVPSSLKASLLEKVLAVLEVWKTGDPLDPDVKLGSLIEEMHFEKVLAHIEKARAE 361

Query: 364 GAKLLAGGKRTLEETGGTYVEPTIFDGVTNAMRIAQEEIFGPVLSVIAFDTAEEAVAIAN 423
           GA+L+ GGK T  ++GG +VEPTIFD VT  MRIA++E+FGPV+  I +   +EAV IAN
Sbjct: 362 GARLVCGGKATRTDSGGWFVEPTIFDNVTPQMRIARDEVFGPVVCFIEYADIDEAVHIAN 421

Query: 424 DTPYGLAAGIWTSDISKAHKTARAVRAGSVWVNQYDGGDMTAPFGGFKQSG-NGRDKSLH 482
           DT YGLAA +WT +++ AHK A  +RAG+V VN +  GD++ PFGGFKQSG  GRDKS++
Sbjct: 422 DTCYGLAASLWTDNVNHAHKIAARIRAGTVTVNCFGEGDLSTPFGGFKQSGFGGRDKSVY 481

Query: 483 ALEKYTELKATWIKL 497
           A ++Y ELK TW+KL
Sbjct: 482 AHDQYCELKTTWLKL 496


Lambda     K      H
   0.316    0.132    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 663
Number of extensions: 24
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 497
Length of database: 497
Length adjustment: 34
Effective length of query: 463
Effective length of database: 463
Effective search space:   214369
Effective search space used:   214369
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory