GapMind for catabolism of small carbon sources

 

Aligments for a candidate for put1 in Paraburkholderia bryophila 376MFSha3.1

Align proline dehydrogenase (EC 1.5.5.2) (characterized)
to candidate H281DRAFT_02458 H281DRAFT_02458 sarcosine oxidase subunit alpha

Query= BRENDA::Q76M76
         (483 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_02458 H281DRAFT_02458
           sarcosine oxidase subunit alpha
          Length = 1000

 Score =  139 bits (351), Expect = 3e-37
 Identities = 139/506 (27%), Positives = 219/506 (43%), Gaps = 79/506 (15%)

Query: 15  RGRKVTIHFEGQPVEAYEGETIAMALHAAGIRVLSHSAEKHRPRGLFCAIGKCSSCLVKV 74
           R   +T  F G+  + Y+G+T+A AL A G+  ++ S + HRPRG+  A  +  + +V++
Sbjct: 15  RALPLTFTFNGRQYQGYQGDTLASALLANGLHFVARSWKYHRPRGIVTAGVEEPNAVVQL 74

Query: 75  NG----VPNVRSCITLVEEGMKVEMQRGKETLPKG------------------------- 105
                 VPN R+    + +G+       K ++ K                          
Sbjct: 75  ETGAYTVPNARATEVELYQGLVANSVNAKPSIEKDRMAVNQKLARFIPAGFYYKTFMWPR 134

Query: 106 ----------------AKPPAWKDAPRYK-----ADVVVIGGGPAGLMAAIHAADAGASV 144
                            K P   DA RY       DV+V+GGGP GL AA  AA +GA V
Sbjct: 135 KFWPKYEEVIRDAAGLGKAPEQLDADRYDKCFAHCDVLVVGGGPTGLAAAHAAALSGARV 194

Query: 145 ILIDENPMLGGQLVKQTHKFFGKREQFAGVRGVKIAEILGEEVKKRGNIEVFLETSAVG- 203
            L+D+ P LGG L+         R +  G   ++    + +E+++  ++++   ++A G 
Sbjct: 195 TLVDDQPELGGSLLSC-------RAEIDGKPALQWVHKIEDELRQMPDVKILTRSTAFGY 247

Query: 204 -------VFHEGEEKLVAAVRKN-KELL-EFLGKTLVVATGAMEKMIPFENNDLPGIYGA 254
                  V     + L  + RK  +EL+ +   K +++ATGA E+ I F NNDLPG+  A
Sbjct: 248 QDHNLVTVTQRLTDHLPVSQRKGTRELMWKIRAKRVILATGAHERPIVFGNNDLPGVMLA 307

Query: 255 GAIQTLMNTYGVKPGDRVLIVGAGNVGLILAYQLIQAGVEVKAIVEAMPKVGGYFVHAAK 314
            A+ T ++ Y V PG   ++    + G   A  L  AG +V  I     +  G     A 
Sbjct: 308 SAVSTYLHRYAVLPGRNAVVFTNNDDGYQCALDLKAAGAQVTVIDPRAGESKGTL--PAL 365

Query: 315 VRRLGVPILTRHTILRAEGKDRVERAVIAQLDENWRPVPGTEKVFEVDTIALAVGLRPSI 374
            RR GV ++    I  A GK RV    IA           +E     D +A++ G  P +
Sbjct: 366 ARRYGVKVIGGAVITAAHGKLRVASVDIASYANGKTGAKQSE--LPCDLLAMSGGWSPVL 423

Query: 375 ELLHQAGCQVKFVRELSGHVAVRDGRMETTV---QGIFVAGDSAGIEEATTAMLEGKIAG 431
            L  Q+G +  +  E +  V  +  + ET+V    G F  G   GI  A  A +E   A 
Sbjct: 424 HLFAQSGGKAHWHNEKACFVPGKAMQAETSVGACNGDFTLGQ--GIRFAVDAGIE---AA 478

Query: 432 IAAALKAGAASPEWLAEIEKAQRDLL 457
            AA       +P  +AEI +A+ + L
Sbjct: 479 RAAGHIVARPNPVQVAEISEAKLEPL 504


Lambda     K      H
   0.319    0.138    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1054
Number of extensions: 68
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 483
Length of database: 1000
Length adjustment: 39
Effective length of query: 444
Effective length of database: 961
Effective search space:   426684
Effective search space used:   426684
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory