GapMind for catabolism of small carbon sources

 

Aligments for a candidate for puuB in Paraburkholderia bryophila 376MFSha3.1

Align gamma-glutamylputrescine oxidase (EC 1.4.3.-) (characterized)
to candidate H281DRAFT_03219 H281DRAFT_03219 gamma-glutamylputrescine oxidase

Query= reanno::pseudo5_N2C3_1:AO356_21495
         (427 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_03219 H281DRAFT_03219
           gamma-glutamylputrescine oxidase
          Length = 429

 Score =  261 bits (666), Expect = 4e-74
 Identities = 153/413 (37%), Positives = 227/413 (54%), Gaps = 8/413 (1%)

Query: 8   ESYYAASANPVPPRPALQDDVETDVCVIGAGYTGLSSALFLLENGFK-VTVLEAAKVGFG 66
           ES+Y A+         L      DVC++G G  GLS+AL L+E G K V VLEA +VG+G
Sbjct: 2   ESFYEATVTRPSAYAPLVGQHSADVCIVGGGLAGLSTALGLVERGVKNVAVLEARQVGYG 61

Query: 67  ASGRNGGQIVNSYSRDIDVIERSVGPQQAQLLGNMAFEGGRIIRERVAKYQIQCDLKDGG 126
           ASGRNGG +   YS D   + +++G  +A+ L  +  +   ++R R+A+Y+I CD+ D G
Sbjct: 62  ASGRNGGFVFGGYSLDCADLLKTLGASRARELYALTTDAVDLMRARIARYRIDCDVTDAG 121

Query: 127 VFAALTAKQMGHLESQKRLW-ERFGHTQLELLDQRRIREVVACEEYVGGMLDMSGGHIHP 185
           V  A    +   LE+Q+RL  E FG    E +    +   +    Y GG+ + +  H HP
Sbjct: 122 VILANWFDEPARLEAQRRLMLESFG-VDWEPVAAEHLARQLKTRRYHGGLYERNAFHFHP 180

Query: 186 LNLALGEAAAVESLGGVIYEQSPAVRIER-GASPVVHTPQGKVRAKFIIVAGNAYLGNLV 244
           L   LG A A  S G  I+EQSP V ++R GA  V+ TPQG + A+ +++AG  Y  N+ 
Sbjct: 181 LKYVLGVAQAAVSAGVRIHEQSPVVHLQRDGAGFVLRTPQGVIDARHVVMAGGGYARNVY 240

Query: 245 PELAAKSMPCGTQVIATEPLGDELAHSLLPQDYCVEDCNYLLDYYRLTGDKRLIFGGGVV 304
            ++    +P  T V+ATEPLG  L H  +     V D  +  DYYR   D R+++GG + 
Sbjct: 241 AKVERAVLPIATYVMATEPLGARL-HDAIDTRAAVYDTRFAFDYYRPLPDTRILWGGRIS 299

Query: 305 YGARDPANIEAIIRPKMLKAFPQLKDVKIDYAWTGNFLLTLSRLPQVGRLGDNIYYSQGC 364
              R P  I  ++R  +LK +PQL DV++DYAW G       ++PQ+GR  D ++++ G 
Sbjct: 300 VRDRAPEVIARLLRRDLLKVYPQLHDVRVDYAWGGLMSYARHKMPQIGRTADGVWHAVGF 359

Query: 365 SGHGVTYTHLAGKVLAEALRGQ---AERFDAFADLPHYPFPGGQLLRTPFAAM 414
            GHG+  T ++G++LA A+ G+    E F AF   P Y   G    +  + AM
Sbjct: 360 GGHGMAPTTVSGELLAAAIAGERAVPEAFAAFGLTPAYGALGLAAAQLTYTAM 412


Lambda     K      H
   0.320    0.139    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 527
Number of extensions: 33
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 427
Length of database: 429
Length adjustment: 32
Effective length of query: 395
Effective length of database: 397
Effective search space:   156815
Effective search space used:   156815
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory