GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rocA in Paraburkholderia bryophila 376MFSha3.1

Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized)
to candidate H281DRAFT_03016 H281DRAFT_03016 aldehyde dehydrogenase (acceptor)

Query= BRENDA::Q9K9B2
         (515 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_03016 H281DRAFT_03016
           aldehyde dehydrogenase (acceptor)
          Length = 483

 Score =  274 bits (701), Expect = 5e-78
 Identities = 168/471 (35%), Positives = 255/471 (54%), Gaps = 22/471 (4%)

Query: 35  KEYPLIINGERVT--TEDKIQSWNPARKDQLVGSVSKANQDLAEKAIQSADEAFQTWRNV 92
           + + L+I+G+R+   T +   + NPA ++  +  V++ +    + A+++A  A + W  +
Sbjct: 8   RRHDLLIDGKRLPPGTGEYSVNINPATEEP-IAHVAQGSAADVDTAVRAARAALKVWNGI 66

Query: 93  NPEERANILVKAAAIIRRRKHEFSAWLVHEAGKPWKEA-DADTAEAIDFLEYYARQMIEL 151
              ER  IL + A ++R    E +A    +AGKP       D   AID LEYYA    ++
Sbjct: 67  KAAERGRILSRLAGLMRANLDELAALESLDAGKPIAAVMRQDVPAAIDTLEYYAGWCDKI 126

Query: 152 NRGKEILSRPGEQNRYFYTPMGVTVTISPWNFALAIMVGTAVAPIVTGNTVVLKPASTTP 211
           N G+ +  RP         P+GV   I PWNF L I +      +  G T+++KPA  TP
Sbjct: 127 N-GQVVPVRPDALTYTLREPVGVVAAIVPWNFPLMIGMWKIAPALACGCTLIVKPAEITP 185

Query: 212 VVAAKFVEVLEDAGLPKGVINYVPGSGAEVGDYLVDHPKTSLITFTGSKDVGVRLYERAA 271
           + A +  E+  +AG+P GV+N V G G  VGD LV HP    +TFTGS  VG  + + AA
Sbjct: 186 LSALRIGELALEAGVPPGVLNIVTGKGRVVGDALVAHPGVDKVTFTGSPSVGRGILQGAA 245

Query: 272 VVRPGQNHLKRVIVEMGGKDTVVVDRDADLDLAAESILVSAFGFSGQKCSAGSRAVIHKD 331
                  + KRV +E+GGK   ++  DA+LD A  +     F  +GQ CSAGSR + H+D
Sbjct: 246 ------GNFKRVTLELGGKSANLIFPDANLDNAVRAAASGIFFNTGQVCSAGSRILAHRD 299

Query: 332 VYDEVLEKTVALAKNLTVGDPTNRDNYMGPVIDEKAFEKIMSYIEIGKKEG-RLMTGGEG 390
           VYDEV+E+  A AK++ VGDP++R+  MGP+I     + ++ Y++ G+ EG  L+TGG  
Sbjct: 300 VYDEVVERLAARAKSIKVGDPSSRETSMGPLISAAQMKTVLGYVDAGRSEGASLVTGGGR 359

Query: 391 DSSTGFFIQPTIIADLDPEAVIMQEEIFGPVVAFSKANDFDHALEIANNTEYGLTGAVIT 450
               GFF++PT+ A+++ E  I QEEIFGPV +  + ND   A+ IAN T Y L   V +
Sbjct: 360 IGERGFFVEPTVFANVEHEMRISQEEIFGPVASVIRFNDEADAIRIANGTLYSLAAGVWS 419

Query: 451 RNRAHIEQAKREFHVGNLYFNRNCTGAIVGYH----PFGGFKMSGTDSKAG 497
            +   + +  R+   G ++ N        GY     P+GG   SG   + G
Sbjct: 420 ADIGRVHRVARDLRAGTVWIN------TYGYTDVRLPWGGSGDSGFGREHG 464


Lambda     K      H
   0.316    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 578
Number of extensions: 19
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 515
Length of database: 483
Length adjustment: 34
Effective length of query: 481
Effective length of database: 449
Effective search space:   215969
Effective search space used:   215969
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory