GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rocE in Paraburkholderia bryophila 376MFSha3.1

Align Amino-acid permease RocE (characterized)
to candidate H281DRAFT_04042 H281DRAFT_04042 aromatic amino acid:proton symporter, AAT family

Query= SwissProt::P39137
         (467 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_04042 H281DRAFT_04042
           aromatic amino acid:proton symporter, AAT family
          Length = 506

 Score =  291 bits (745), Expect = 3e-83
 Identities = 156/464 (33%), Positives = 260/464 (56%), Gaps = 12/464 (2%)

Query: 1   MNTNQDNGNQ---LQRTMKSRHLFMISLGGVIGTGFFLGTGFTINQAGPLGAVLSYLVGG 57
           +  N DN  Q   L+R +K+RH+ +I+LGG IGTG FLG+   +  AGP   +L Y +GG
Sbjct: 42  LGRNLDNALQQDGLKRGLKNRHIQLIALGGAIGTGLFLGSASVLQAAGP-SMILGYAIGG 100

Query: 58  FIMFLTMLCLGELAVAFPVSGSFQTYATKFISPAFGFAFGWLYWLGWAVTCAIEFLSAGQ 117
            I F+ M  LGE+    PV+GSF  +A K+     GF  GW YW+ + +    E  + G 
Sbjct: 101 VIAFMIMRQLGEMVAQEPVAGSFSHFAYKYWGDFPGFLSGWNYWVLYVLVSMAELTAVGT 160

Query: 118 LMQRWFPHIDVWIWCLVFAALMFILNAITTKAFAESEFWFSGIKILIILLFIILGGAAMF 177
            +  W+P +  W+  LV  A +  +N    KA+ E+EFWF+ IK++ ++  I+ GG   +
Sbjct: 161 YVHYWWPGVPTWVSALVCFAGINAINLANVKAYGETEFWFAIIKVVAVIGMILFGG---Y 217

Query: 178 GLIDLKGGEQAPFLTHFYEDGLFPNGIKAMLITMITVNFAFQGTELIGVAAGESEDPEKT 237
            L+   GG QA     +   G FP+G   +   +  + F+F G ELIG+ A E+++P+K+
Sbjct: 218 LLVSGHGGPQASISNLWSHGGFFPHGFHGLFTMLAVIMFSFGGLELIGITAAEADEPQKS 277

Query: 238 IPRSIKQTVWRTLVFFVLSIIVIAGMIPWKQAGVVESPFVAVFEQIGIPYAADIMNFVIL 297
           IP+++ Q ++R L+F++ S+ V+  + PW +     SPFV +F QIG    A+++N V+L
Sbjct: 278 IPKAVNQVIYRILIFYICSLAVLLSLYPWNEVAAGGSPFVMIFSQIGSTLTANVLNVVVL 337

Query: 298 IALLSVANSGLYASTRILYAMANEGQAFKALGKTNQRGVPMYSLIVTMAVACLSLLTKFA 357
            A LSV NSG+YA++R+LY +A +G A +AL K ++RGVP  ++ ++       ++  + 
Sbjct: 338 TAALSVYNSGVYANSRMLYGLAEQGNAPRALMKVDRRGVPYMAIGLSALATFTCVIVNYL 397

Query: 358 QAETVYMVLLSLAGMSAQVGWITISLSQIMFRRKYIREGGKIEDLKFKTPLYPVLPLIGL 417
                  +L++L   +  + W  ISL+ +  RR  +  G   E L FK+  +PV   I L
Sbjct: 398 IPAEALGLLMALVVAALVLNWALISLTHLKSRRAMVAAG---ETLVFKSFWFPVSNWICL 454

Query: 418 TLNTVVLISLAFDPEQRIALYCGVPFMIICYIIYHVVIKKRQQA 461
               ++L+ LA  P   +++     ++++ +  Y    K+R+ A
Sbjct: 455 AFMALILVILAMTPGLSVSVLLVPVWLVVMWAGY--AFKRRRAA 496


Lambda     K      H
   0.329    0.142    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 573
Number of extensions: 25
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 467
Length of database: 506
Length adjustment: 34
Effective length of query: 433
Effective length of database: 472
Effective search space:   204376
Effective search space used:   204376
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory