Align agmatinase (EC 3.5.3.11) (characterized)
to candidate H281DRAFT_00178 H281DRAFT_00178 agmatinase
Query= BRENDA::W5PHZ9 (361 letters) >lcl|FitnessBrowser__Burk376:H281DRAFT_00178 H281DRAFT_00178 agmatinase Length = 329 Score = 406 bits (1043), Expect = e-118 Identities = 200/311 (64%), Positives = 235/311 (75%) Query: 48 GPRNQPPSSEFVARSVGICSMMRLPMQATPEGLDAALVGVPLDIGTSNRPGARFGPRRIR 107 G R QP S + RS GI +MMRLP + EG DA VGVP D+GTSNR GARFGPR+IR Sbjct: 12 GERPQPLSGNAMPRSGGIATMMRLPNVGSAEGFDACFVGVPFDLGTSNRTGARFGPRQIR 71 Query: 108 EESVMLRTANPSTGAVPFQFLKVADLGDVNVNLYNLQDSCRLIRADYQKIVAAGCVPLTL 167 ESV+LR N +T A PF L+VADLGDV +N YNL DS I Y +I+ C P+TL Sbjct: 72 SESVLLRPYNMATRAAPFDSLRVADLGDVAINPYNLHDSIARIETAYDEILQHDCKPVTL 131 Query: 168 GGDHTITYPILQAIAEKHGPVGLVHVDAHMDTADKALGEKLYHGTPFRRCVDEGLLDCKR 227 GGDHTI PIL+AI KHG VGL+HVDAH D D +GEK+ HGTPFRR V+EGLLDC+R Sbjct: 132 GGDHTIALPILRAIHRKHGKVGLIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLDCER 191 Query: 228 VVQIGIRGSSTTLDTYRYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMGGRPIYISFDID 287 VVQIG+RG+ + + + R QGF VV AE CW +SL PLM VR++MG P+YI+FDID Sbjct: 192 VVQIGLRGTGYAAEDFDWCRDQGFDVVQAEACWNQSLAPLMARVRERMGDGPVYITFDID 251 Query: 288 GLDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDPSGNTALVAANL 347 G+DPA+APGTGTPEIAGLT QALEIIRG +GLN+VGCDLVEV+PPYDP G TAL+AANL Sbjct: 252 GIDPAFAPGTGTPEIAGLTVPQALEIIRGARGLNIVGCDLVEVAPPYDPFGTTALLAANL 311 Query: 348 LFEMLCVLPKV 358 FE+LCVLP V Sbjct: 312 AFELLCVLPGV 322 Lambda K H 0.321 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 329 Length adjustment: 29 Effective length of query: 332 Effective length of database: 300 Effective search space: 99600 Effective search space used: 99600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate H281DRAFT_00178 H281DRAFT_00178 (agmatinase)
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01230.hmm # target sequence database: /tmp/gapView.3370.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01230 [M=275] Accession: TIGR01230 Description: agmatinase: agmatinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-68 216.9 0.0 2.6e-68 216.6 0.0 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_00178 H281DRAFT_00178 agmatinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_00178 H281DRAFT_00178 agmatinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 216.6 0.0 2.6e-68 2.6e-68 12 274 .. 43 317 .. 32 318 .. 0.93 Alignments for each domain: == domain 1 score: 216.6 bits; conditional E-value: 2.6e-68 TIGR01230 12 eAevvivgiPydattsyrpGsrhgpeaireastnLeayseeld.rdlallkvvDagdlplaaGdar 76 ++ vg+P+d ts r G+r+gp +ir s+ L y+ ++ l+v+D+gd+ + + + lcl|FitnessBrowser__Burk376:H281DRAFT_00178 43 GFDACFVGVPFDLGTSNRTGARFGPRQIRSESVLLRPYNMATRaAPFDSLRVADLGDVAINPYNLH 108 5578899*******************************98877588**************99999* PP TIGR01230 77 emvekieevveelleegkfvvaiGGeHsitlpvirAvkkkfeklavvqfDAHtDlrdefegeklsh 142 +++ +ie +e+l++ ++v++GG+H+i+lp++rA+++k++k+ ++++DAH+D+ d gek+ h lcl|FitnessBrowser__Burk376:H281DRAFT_00178 109 DSIARIETAYDEILQHDCKPVTLGGDHTIALPILRAIHRKHGKVGLIHVDAHADVNDTMMGEKIAH 174 ****************************************************************** PP TIGR01230 143 acvmrrvlelg....lnvlqigiRsg..ikeeadlarennikvlkrelede......iaevlakvl 196 ++ rr++e g +v+qig+R e++d+ r+++ +v++ e + +a+v ++ lcl|FitnessBrowser__Burk376:H281DRAFT_00178 175 GTPFRRAVEEGlldcERVVQIGLRGTgyAAEDFDWCRDQGFDVVQAEACWNqslaplMARVRERMG 240 *********99877789*******753378*************9966554446666688999999* PP TIGR01230 197 dkpvyvtiDiDvlDPafaPGvgtpepgGltskellklfvlaekekkvvGlDvvEvaPvydssevta 262 d pvy+t+DiD++DPafaPG+gtpe++Glt ++l+ ++ ++vG+D+vEvaP yd ta lcl|FitnessBrowser__Burk376:H281DRAFT_00178 241 DGPVYITFDIDGIDPAFAPGTGTPEIAGLTVPQALE-IIRGARGLNIVGCDLVEVAPPYDPFGTTA 305 ************************************.889999*********************** PP TIGR01230 263 ltaaklalelll 274 l+aa+la ell lcl|FitnessBrowser__Burk376:H281DRAFT_00178 306 LLAANLAFELLC 317 *********996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (275 nodes) Target sequences: 1 (329 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.02 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory