GapMind for catabolism of small carbon sources

 

Aligments for a candidate for speB in Paraburkholderia bryophila 376MFSha3.1

Align agmatinase (EC 3.5.3.11) (characterized)
to candidate H281DRAFT_00178 H281DRAFT_00178 agmatinase

Query= BRENDA::W5PHZ9
         (361 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_00178 H281DRAFT_00178
           agmatinase
          Length = 329

 Score =  406 bits (1043), Expect = e-118
 Identities = 200/311 (64%), Positives = 235/311 (75%)

Query: 48  GPRNQPPSSEFVARSVGICSMMRLPMQATPEGLDAALVGVPLDIGTSNRPGARFGPRRIR 107
           G R QP S   + RS GI +MMRLP   + EG DA  VGVP D+GTSNR GARFGPR+IR
Sbjct: 12  GERPQPLSGNAMPRSGGIATMMRLPNVGSAEGFDACFVGVPFDLGTSNRTGARFGPRQIR 71

Query: 108 EESVMLRTANPSTGAVPFQFLKVADLGDVNVNLYNLQDSCRLIRADYQKIVAAGCVPLTL 167
            ESV+LR  N +T A PF  L+VADLGDV +N YNL DS   I   Y +I+   C P+TL
Sbjct: 72  SESVLLRPYNMATRAAPFDSLRVADLGDVAINPYNLHDSIARIETAYDEILQHDCKPVTL 131

Query: 168 GGDHTITYPILQAIAEKHGPVGLVHVDAHMDTADKALGEKLYHGTPFRRCVDEGLLDCKR 227
           GGDHTI  PIL+AI  KHG VGL+HVDAH D  D  +GEK+ HGTPFRR V+EGLLDC+R
Sbjct: 132 GGDHTIALPILRAIHRKHGKVGLIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLDCER 191

Query: 228 VVQIGIRGSSTTLDTYRYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMGGRPIYISFDID 287
           VVQIG+RG+    + + + R QGF VV AE CW +SL PLM  VR++MG  P+YI+FDID
Sbjct: 192 VVQIGLRGTGYAAEDFDWCRDQGFDVVQAEACWNQSLAPLMARVRERMGDGPVYITFDID 251

Query: 288 GLDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDPSGNTALVAANL 347
           G+DPA+APGTGTPEIAGLT  QALEIIRG +GLN+VGCDLVEV+PPYDP G TAL+AANL
Sbjct: 252 GIDPAFAPGTGTPEIAGLTVPQALEIIRGARGLNIVGCDLVEVAPPYDPFGTTALLAANL 311

Query: 348 LFEMLCVLPKV 358
            FE+LCVLP V
Sbjct: 312 AFELLCVLPGV 322


Lambda     K      H
   0.321    0.139    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 427
Number of extensions: 15
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 361
Length of database: 329
Length adjustment: 29
Effective length of query: 332
Effective length of database: 300
Effective search space:    99600
Effective search space used:    99600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate H281DRAFT_00178 H281DRAFT_00178 (agmatinase)
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01230.hmm
# target sequence database:        /tmp/gapView.24099.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01230  [M=275]
Accession:   TIGR01230
Description: agmatinase: agmatinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
    2.2e-68  216.9   0.0    2.6e-68  216.6   0.0    1.0  1  lcl|FitnessBrowser__Burk376:H281DRAFT_00178  H281DRAFT_00178 agmatinase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Burk376:H281DRAFT_00178  H281DRAFT_00178 agmatinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  216.6   0.0   2.6e-68   2.6e-68      12     274 ..      43     317 ..      32     318 .. 0.93

  Alignments for each domain:
  == domain 1  score: 216.6 bits;  conditional E-value: 2.6e-68
                                    TIGR01230  12 eAevvivgiPydattsyrpGsrhgpeaireastnLeayseeld.rdlallkvvDagdlplaaGdar 76 
                                                    ++  vg+P+d  ts r G+r+gp +ir  s+ L  y+       ++ l+v+D+gd+ +   + +
  lcl|FitnessBrowser__Burk376:H281DRAFT_00178  43 GFDACFVGVPFDLGTSNRTGARFGPRQIRSESVLLRPYNMATRaAPFDSLRVADLGDVAINPYNLH 108
                                                  5578899*******************************98877588**************99999* PP

                                    TIGR01230  77 emvekieevveelleegkfvvaiGGeHsitlpvirAvkkkfeklavvqfDAHtDlrdefegeklsh 142
                                                  +++ +ie   +e+l++  ++v++GG+H+i+lp++rA+++k++k+ ++++DAH+D+ d   gek+ h
  lcl|FitnessBrowser__Burk376:H281DRAFT_00178 109 DSIARIETAYDEILQHDCKPVTLGGDHTIALPILRAIHRKHGKVGLIHVDAHADVNDTMMGEKIAH 174
                                                  ****************************************************************** PP

                                    TIGR01230 143 acvmrrvlelg....lnvlqigiRsg..ikeeadlarennikvlkrelede......iaevlakvl 196
                                                   ++ rr++e g     +v+qig+R      e++d+ r+++ +v++ e   +      +a+v  ++ 
  lcl|FitnessBrowser__Burk376:H281DRAFT_00178 175 GTPFRRAVEEGlldcERVVQIGLRGTgyAAEDFDWCRDQGFDVVQAEACWNqslaplMARVRERMG 240
                                                  *********99877789*******753378*************9966554446666688999999* PP

                                    TIGR01230 197 dkpvyvtiDiDvlDPafaPGvgtpepgGltskellklfvlaekekkvvGlDvvEvaPvydssevta 262
                                                  d pvy+t+DiD++DPafaPG+gtpe++Glt  ++l+   ++    ++vG+D+vEvaP yd    ta
  lcl|FitnessBrowser__Burk376:H281DRAFT_00178 241 DGPVYITFDIDGIDPAFAPGTGTPEIAGLTVPQALE-IIRGARGLNIVGCDLVEVAPPYDPFGTTA 305
                                                  ************************************.889999*********************** PP

                                    TIGR01230 263 ltaaklalelll 274
                                                  l+aa+la ell 
  lcl|FitnessBrowser__Burk376:H281DRAFT_00178 306 LLAANLAFELLC 317
                                                  *********996 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (275 nodes)
Target sequences:                          1  (329 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 11.01
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory