Align ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized)
to candidate H281DRAFT_06476 H281DRAFT_06476 amino acid ABC transporter ATP-binding protein, PAAT family
Query= reanno::pseudo1_N1B4:Pf1N1B4_774 (244 letters) >FitnessBrowser__Burk376:H281DRAFT_06476 Length = 263 Score = 225 bits (574), Expect = 6e-64 Identities = 122/255 (47%), Positives = 173/255 (67%), Gaps = 16/255 (6%) Query: 2 ISIKNVNKWYGDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDVIVD 61 +++++++K YGD +VL S KG+VI + G SGSGKST ++C+N LE G ++VD Sbjct: 12 LAVQDIHKRYGDNEVLKGVSLNANKGDVISIIGASGSGKSTFLRCINFLERPNAGQIVVD 71 Query: 62 GTSI------------ADPKTNLPKLRSRVGMVFQHFELFPHLSIMDNLTIAQVKVLGRS 109 G ++ AD K L ++R+++ MVFQHF L+ H+++++N+ A + VLG Sbjct: 72 GETVKTKADRAGNLEVADHK-QLQRIRTKLAMVFQHFNLWAHMNVIENIVEAPIHVLGLP 130 Query: 110 KEEASKKALQLLERVGLSAHAKK-HPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALD 168 + EA ++A + LE+VGL+ +K +P LSGGQQQRVAIARALAMDP VMLFDEPTSALD Sbjct: 131 RREAEERAREYLEKVGLAPRLEKQYPSHLSGGQQQRVAIARALAMDPDVMLFDEPTSALD 190 Query: 169 PEMVNEVLDVMVQLAHEGMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEEFFGDIT 228 PE+V EVL VM +LA EG TM+ VTHEMGFAR V++ V+F+ QG+ E+ E + Sbjct: 191 PELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRTEEEGLPAEVLS--S 248 Query: 229 ARSDRAQHFLEKILQ 243 RS+R + FL L+ Sbjct: 249 PRSERLKQFLSGSLK 263 Lambda K H 0.321 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 263 Length adjustment: 24 Effective length of query: 220 Effective length of database: 239 Effective search space: 52580 Effective search space used: 52580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory