Align ATPase (characterized, see rationale)
to candidate H281DRAFT_03348 H281DRAFT_03348 amino acid ABC transporter ATP-binding protein, PAAT family
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__Burk376:H281DRAFT_03348 Length = 258 Score = 255 bits (651), Expect = 7e-73 Identities = 140/256 (54%), Positives = 174/256 (67%), Gaps = 6/256 (2%) Query: 11 VTAIASAPETMIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNA 70 + +A E ++ G+ K +G+ L G+ + +VVV++GPSGSGKSTFLR N Sbjct: 1 MNTVAKVNEPIVSIRGLTKSFGSH-TVLNGIDFDIHPQQVVVVIGPSGSGKSTFLRCCNG 59 Query: 71 LESHQRGEIWIEGHRLSHD-----RRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQ 125 LE +RG I I GHRL R + +R EVGMVFQ FNLFPHL+VL N+ + P Sbjct: 60 LEQAERGTIDICGHRLVDQGAMLKERSLNALRTEVGMVFQSFNLFPHLSVLHNITVGPRM 119 Query: 126 VRRWPVAQAEATARQLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPT 185 +R AQAEA A LLE+V +A +AD P LSGGQ+QRVAIARALAMQPR++LFDEPT Sbjct: 120 LRGASKAQAEAAAIALLEKVGLAHKADVMPASLSGGQKQRVAIARALAMQPRVMLFDEPT 179 Query: 186 SALDPEMVREVLDVMRDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFF 245 SALDPE+V EVL VM+ LASEGMTM+V THE+GFA+EVAD VV+M G IVE PP F Sbjct: 180 SALDPELVGEVLQVMKLLASEGMTMVVVTHEMGFAKEVADVVVVMDGGVIVEAGPPAEIF 239 Query: 246 TAPQSDRAKQFLAQIL 261 +AP R + FL +L Sbjct: 240 SAPSQPRTRAFLQAVL 255 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 258 Length adjustment: 24 Effective length of query: 237 Effective length of database: 234 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory