Align ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)
to candidate H281DRAFT_05873 H281DRAFT_05873 amino acid ABC transporter ATP-binding protein, PAAT family
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4773 (244 letters) >FitnessBrowser__Burk376:H281DRAFT_05873 Length = 250 Score = 240 bits (612), Expect = 2e-68 Identities = 126/244 (51%), Positives = 170/244 (69%), Gaps = 3/244 (1%) Query: 1 MISIKSINKWYGDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDIVV 60 +IS+ ++K +G +VL D + +V+ GEV+V+ G SGSGKST+++ + LE G++ V Sbjct: 10 VISLSGVSKSFGATRVLNDINLDVRAGEVLVLIGASGSGKSTVLRIMAGLETTDSGEVWV 69 Query: 61 DGTSIADPKTNLPKLRSRVGMVFQHFELFPHLTITENLTIAQIKVLGRSKEEATKKGLQL 120 + + DPK ++R VGMVFQ F LFPH T N+T+A IK G S +A K+ + Sbjct: 70 NEVPLHDPK-RAREIRGHVGMVFQQFNLFPHKTALGNVTLALIKARGMSPADARKRAMDS 128 Query: 121 LERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEVLDVMV 180 L+RVGL+ A +P QLSGGQQQRVAIARALA++P +M FDE TSALDPE+V EV +VM Sbjct: 129 LDRVGLADRASHYPSQLSGGQQQRVAIARALAVEPGIMFFDEATSALDPELVGEVTEVMR 188 Query: 181 QLAHEGMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEEFFGDINARAERTQHFLNK 240 LA +GMTM+ VTHEMGFARK ADRV+FMD+G I E E+ F +N ERT+ FL++ Sbjct: 189 GLARDGMTMVVVTHEMGFARKTADRVLFMDKGVIAEQGDPEQIF--VNPSNERTRQFLSR 246 Query: 241 ILQH 244 +L H Sbjct: 247 VLDH 250 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 250 Length adjustment: 24 Effective length of query: 220 Effective length of database: 226 Effective search space: 49720 Effective search space used: 49720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory