Align NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)
to candidate H281DRAFT_04269 H281DRAFT_04269 L-glutamate ABC transporter membrane protein /L-aspartate ABC transporter membrane protein
Query= TCDB::Q8YPM8 (308 letters) >FitnessBrowser__Burk376:H281DRAFT_04269 Length = 246 Score = 113 bits (282), Expect = 5e-30 Identities = 76/239 (31%), Positives = 121/239 (50%), Gaps = 18/239 (7%) Query: 70 KPTDTYSLALWVGLINSLRIAFVGIILTTIVGILAGIARLSDNWLVRNISLVYVEIFRNT 129 +PT TY L G ++ ++ ++ IVG L G+ R N I +YV IFRN Sbjct: 18 EPT-TYLGWLLSGFWVTITVSLSAWVIALIVGSLFGVLRTVPNKWASGIGTLYVAIFRNI 76 Query: 130 PLLLQLLFWYFAVFLGLPRADNKISLGGFIGLSQNGLELPWFTFSPEFSALLLGLIFYTG 189 PL++Q WY + LP +S+G + G + FS+ ++ L +T Sbjct: 77 PLIVQFFIWYLVIPELLP-----VSMGTWFKQLPPGAQF--------FSSSIICLGLFTA 123 Query: 190 AFIAEIVRGGIQSVSKGQWEAGRSLGLNPSLIMRLVIFPQALRVIIPPLTSQYLNLTKNS 249 A + E VR GI ++ +GQ AG ++G R V+ P A R+I+PPLTS++LN+ KNS Sbjct: 124 ARVCEQVRSGINALPRGQRAAGLAMGFTQWQTYRYVLLPVAYRIIVPPLTSEFLNIFKNS 183 Query: 250 SLAIAIGYPDIYFVASTTFNQTGKAVEVMLLLMLTYLSLSLTISLIMNAFNRTVQIKER 308 ++A IG D+ A + T + E + + L Y+ ++L + +M R V+ K R Sbjct: 184 AVASTIGLLDLSAQARQLVDYTSQTYESFIAVTLAYVLINLVVMQLM----RWVEAKTR 238 Lambda K H 0.328 0.143 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 246 Length adjustment: 25 Effective length of query: 283 Effective length of database: 221 Effective search space: 62543 Effective search space used: 62543 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory