Align ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized)
to candidate H281DRAFT_02632 H281DRAFT_02632 carbohydrate ABC transporter membrane protein 2, CUT1 family
Query= reanno::Smeli:SMc04257 (305 letters) >FitnessBrowser__Burk376:H281DRAFT_02632 Length = 283 Score = 149 bits (377), Expect = 6e-41 Identities = 91/276 (32%), Positives = 152/276 (55%), Gaps = 10/276 (3%) Query: 32 VYGTLIVVALY-YLLPLYVMIVTSLKGMPEIRVGNIFAPPLEITFEPWVKAWAEACTGLN 90 +Y + VAL+ +LLP+ +++TS++ E+ G+ +A P + + A T Sbjct: 16 LYKASLPVALFVWLLPMLAVLITSIRSSDELSQGDYWAWPKHFAL---IDNYGAALTQTP 72 Query: 91 CDGLSRGFWNSVRITVPSVIISIAIASVNGYALANWRFKGADLFFTILIVGAFIPYQVMI 150 + F NS+ ITVPSV+ +I +AS+ G+ALA +RF+G + + G F+P Q+++ Sbjct: 73 ---MLHYFANSMLITVPSVLGAILLASMAGFALATYRFRGNIVVLFTFVAGNFVPVQILM 129 Query: 151 YPIVIVLREMGVYGTLTGLIIVHTIFGMPILTLLFRNYFAGLPEELFKAARVDGAGFWTI 210 P+ + ++G++ T+ LII H F TL RN+ LP EL +AARV+GA WTI Sbjct: 130 IPVRDMALKVGLFNTVWALIIFHVAFQTGFCTLFLRNFIKQLPFELIEAARVEGASEWTI 189 Query: 211 YFKIMLPMSLPIFVVAMILQVTGIWNDFLFGVVFTR-PEYYPMTVQLNNIVNSVQGVKEY 269 Y +I+LP+ P IL T +WND+ + + T+ + P+TV + + Q + Sbjct: 190 YARIVLPLIRPALAALGILVFTFVWNDYFWALCLTQGDDAAPITVGVAALKG--QWTTAW 247 Query: 270 NVNMAATILTGLVPLTVYFVSGRLFVRGIAAGAVKG 305 N+ A ++L L + ++F + FV G+ GA KG Sbjct: 248 NLVAAGSVLAALPSVLMFFAMQKHFVAGLTFGASKG 283 Lambda K H 0.329 0.145 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 283 Length adjustment: 26 Effective length of query: 279 Effective length of database: 257 Effective search space: 71703 Effective search space used: 71703 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory