Align CBP protein aka CebF, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate H281DRAFT_03231 H281DRAFT_03231 carbohydrate ABC transporter membrane protein 1, CUT1 family
Query= TCDB::Q9X9R6 (306 letters) >FitnessBrowser__Burk376:H281DRAFT_03231 Length = 321 Score = 109 bits (272), Expect = 1e-28 Identities = 89/295 (30%), Positives = 139/295 (47%), Gaps = 22/295 (7%) Query: 16 KASPYAFVAPFFLLFGAFSLVPLLYTAWYSLHNVQLSALDHKTWAGLDNYENLLSSDFFW 75 + + + F+AP ++ + + P+L T S N + T+ GL NY L + F+ Sbjct: 45 RRAAFLFLAPACVMVAIYVIWPILSTIRLSFFN--WDGMTEPTFVGLANYTELFHTQTFY 102 Query: 76 NALKNTLTIGIISTVPQLLAALALAHLLNYKLRGSTAWRVVMLTPYATSVAAATLVFTLL 135 ALKN L I ++ + LA+A LN + G + + P+ S L+F+ Sbjct: 103 TALKNNL-IWLLLFLLAPPMGLAVALYLNQAVAGIRIVKSLFFAPFVLSGVVVGLIFSWF 161 Query: 136 YSWDGGMVNWILDFFGV----DPVNWRESDWGSQFAVSSIVIWRWTGYNALIYLAAMQAI 191 Y G++ IL GV DP R + G FA +W T Y ++YL + ++ Sbjct: 162 YDPTFGLLAVILGH-GVPVLGDP---RYATLGIVFAA----LWPQTAYCMILYLTGLTSL 213 Query: 192 PADLYESAALDGANRWQQFRHVTVPQLRPTILFTVVVSTIGATQLFGEPLLFGGVSGSKG 251 A+ E+A ++GA W HV +PQLRPT +VV+ IGA + F L ++G G Sbjct: 214 NAEQIEAARMEGARGWSMLWHVILPQLRPTTFMAIVVTIIGALRSFD---LISVMTG--G 268 Query: 252 GSEHQYQTLGLYMYDQGWIIGNLGKASAIAWSMFLILLIVAAVNLLLTRRLRKSQ 306 G L YMYDQ +G ++A+A +F I+L+ + L R LR Q Sbjct: 269 GPFESSTVLAYYMYDQAIKYYRIGYSAAVAVVLFGIMLVYIVYH--LRRMLRAEQ 321 Lambda K H 0.324 0.137 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 321 Length adjustment: 27 Effective length of query: 279 Effective length of database: 294 Effective search space: 82026 Effective search space used: 82026 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory