Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate H281DRAFT_05887 H281DRAFT_05887 carbohydrate ABC transporter ATP-binding protein, CUT1 family
Query= BRENDA::Q97UY8 (353 letters) >FitnessBrowser__Burk376:H281DRAFT_05887 Length = 345 Score = 211 bits (538), Expect = 2e-59 Identities = 116/287 (40%), Positives = 176/287 (61%), Gaps = 21/287 (7%) Query: 1 MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTG 60 M I ++NVSK F G + A+D+++I++ +GE +LGPSGAGKTT +R+IAGL+ P G Sbjct: 1 MAEIQLRNVSKRF--GDIAAVDDISIDVADGEFVVLLGPSGAGKTTTLRLIAGLERPDAG 58 Query: 61 ELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTN--MKMSKEEIR 118 ++ D + V P DR + +FQ ++LYP+LT F N+AFPL + + S+ ++R Sbjct: 59 DVLIDGTIATG-----VHPSDRDVAFIFQQYSLYPHLTVFGNLAFPLRSPRRRSSEADVR 113 Query: 119 KRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDS 178 RV VA++L + L++ LSGG+ QRVA+ RALV+ P L+DEP S+LDA++R+ Sbjct: 114 ARVHAVAEMLHMEAKLDNMATHLSGGEMQRVAIGRALVRQPKAFLMDEPLSSLDAKLREE 173 Query: 179 ARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVA 238 R +K + +G T++ V+HD + +ADR+G+L G+LVQ+G P ++Y NPVS+ A Sbjct: 174 LRIELKRLHRTIGATIVYVTHDQVEATTLADRIGILDHGRLVQLGTPREVYGNPVSLSAA 233 Query: 239 SLIGE--INELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKL 283 +G IN L + S P A +GIRPED+ L Sbjct: 234 QRLGSPPINLL------PPTLFDSAHMPAGT----ATVGIRPEDIVL 270 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 345 Length adjustment: 29 Effective length of query: 324 Effective length of database: 316 Effective search space: 102384 Effective search space used: 102384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory