Align Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate H281DRAFT_02714 H281DRAFT_02714 monosaccharide ABC transporter membrane protein, CUT2 family
Query= TCDB::G4FGN4 (313 letters) >FitnessBrowser__Burk376:H281DRAFT_02714 Length = 331 Score = 256 bits (653), Expect = 7e-73 Identities = 134/309 (43%), Positives = 203/309 (65%), Gaps = 3/309 (0%) Query: 7 KAREAGIFLILIAIVVFLGVTTREFLTVENIFTVILNVSFIAIMSFGMTMVIITSGIDLS 66 + RE + +L+ + + + V + FLT N+ V + S IA+MS GM +VIIT GIDLS Sbjct: 24 RIRELNVLSVLLLVGLLISVFSPYFLTTNNLMGVFRSFSLIALMSIGMMLVIITGGIDLS 83 Query: 67 VGSILGAASVVMGLLMDEKGLSPFLSVVIGLAVGVGFGLANGLLITKARLAPFISTLGML 126 VGS++G +S+V L+ + G + ++ GLAVG+ G NG +IT +L PFI+TLG L Sbjct: 84 VGSVMGLSSLVTALVF-QHGYNAPAAIGAGLAVGIAVGAFNGFMITWIQLPPFIATLGTL 142 Query: 127 SVGRGLAYVMSGGWPISP-FPESFTVHGQGMVGPVPVPVIYMAVIGVIAHIFLKYTVTGR 185 S+GRGL Y+++ G P++P P+SFT GQG +G VP PV+ + + + + ++ T GR Sbjct: 143 SIGRGLMYIITKGVPVTPDVPDSFTFIGQGYIGFVPFPVVILLAMTAVFSVVMRQTRFGR 202 Query: 186 RIYAIGGNMEASKLVGIKTDRILILVYTINGFLAAFAGFLLTAWLGVAQPNAGQGYELDV 245 +YA GGN A++L G++T R+ VY ++G +A+ AG + + A+P +G G ELDV Sbjct: 203 YVYATGGNEVAARLSGVRTARVKFTVYVLSGLIASMAGVIAFSRFVSAEPASGFGAELDV 262 Query: 246 IAATVIGGTSLSGGEGTILGAFLGAVIMGVLRNGMILLGVSSFWQQVVIGIVIIIAIAID 305 IAA IGG SLSGG G++ GA +GA + G++ NG++LL + ++ QQ + G VI+IA++ID Sbjct: 263 IAAAAIGGASLSGGAGSVEGAIIGAALAGIITNGVVLLNIDTYAQQAITGCVILIAVSID 322 Query: 306 QIR-RAKER 313 R R KER Sbjct: 323 IWRVRRKER 331 Lambda K H 0.328 0.145 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 331 Length adjustment: 28 Effective length of query: 285 Effective length of database: 303 Effective search space: 86355 Effective search space used: 86355 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory