Align Citrate:H+ symporter (characterized)
to candidate H281DRAFT_02725 H281DRAFT_02725 MFS transporter, MHS family, proline/betaine transporter
Query= TCDB::P16482 (444 letters) >FitnessBrowser__Burk376:H281DRAFT_02725 Length = 429 Score = 299 bits (765), Expect = 1e-85 Identities = 157/429 (36%), Positives = 247/429 (57%), Gaps = 5/429 (1%) Query: 8 MRASSTAPVRMMATAGGARIGAILRVTS-GNFLEQFDFFLFGFYATYIAHTFFPASSEFA 66 M + A + + A I ++ TS GN LE +D ++G++A+ ++ FFP Sbjct: 1 MSTDTAAMQQPLDAAQSHNIARLIVATSIGNALEFYDLVVYGYFASTLSRLFFPTHDRTV 60 Query: 67 SLMMTFAVFGAGFLMRPIGAIVLGAYIDKVGRRKGLIVTLSIMATGTFLIVLIPSYQTIG 126 SL++T F +L RP+GA+VLG+Y D+ GR+ L +++ +M GT L+ ++P Y TIG Sbjct: 61 SLLLTLGTFALSYLARPVGALVLGSYSDRHGRKASLTLSIGLMTLGTGLVAVMPPYATIG 120 Query: 127 LWAPLLVLIGRLLQGFSAGAELGGVSVYLAEIATPGRKGFYTSWQSGSQQVAIMVAAAMG 186 + AP+L+ + RLLQGFSAG E G + +L E A P R GF +SWQ SQ + ++A+ G Sbjct: 121 IAAPILIFLSRLLQGFSAGGEFGSSTAFLVEHA-PARSGFMSSWQFSSQGASTLLASLFG 179 Query: 187 FALNAVLEPSAISDWGWRIPFLFGVLIVPFIFILRRKLEETQEFTARRHHLAMRQVFATL 246 L +L P + WGWRIPFLFG+LI P +RR+++ET EF AR LA V L Sbjct: 180 ALLTGLLTPPQLEGWGWRIPFLFGMLIGPIGLYIRRRMDETPEF-ARAEKLA-SPVRVVL 237 Query: 247 LANWQVVIAGMMMVAMTTTAFYLITVYAPTFGKKVLMLSASDSLLVTLLVAISNFFWLPV 306 + V+ + + +TTTA Y++ +Y PT+ L LS S + TL+ +PV Sbjct: 238 ATQKERVLVSIGSLVLTTTANYML-LYMPTYATHQLKLSPSSGFIATLVAGFIMMALVPV 296 Query: 307 GGALSDRFGRRSVLIAMTLLALATAWPALTMLANAPSFLMMLSVLLWLSFIYGMYNGAMI 366 G LSD+ GR +++ + +L L T +PA ++ PS M+L+ ++W++ + Y + Sbjct: 297 VGHLSDKLGRIRIMLPVGVLFLVTVYPAFMLMNAYPSLPMLLACVIWVALLKATYFAPIP 356 Query: 367 PALTEIMPAEVRVAGFSLAYSLATAVFGGFTPVISTALIEYTGDKASPGYWMSFAAICGL 426 + ++ P E R G + AY++ T +FGGFTPV+ ALI +T + +PG ++ AA+ L Sbjct: 357 ALMADLFPVETRTTGMAFAYNIGTTIFGGFTPVVVAALIAFTHNNLAPGLYLMIAAVISL 416 Query: 427 LATCYLYRR 435 + RR Sbjct: 417 FTLMWARRR 425 Lambda K H 0.329 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 535 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 429 Length adjustment: 32 Effective length of query: 412 Effective length of database: 397 Effective search space: 163564 Effective search space used: 163564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory