Align Citrate-proton symporter; Citrate carrier protein; Citrate transporter; Citrate utilization determinant; Citrate utilization protein A (characterized)
to candidate H281DRAFT_04917 H281DRAFT_04917 MFS transporter, MHS family, proline/betaine transporter
Query= SwissProt::P0A2G3 (434 letters) >FitnessBrowser__Burk376:H281DRAFT_04917 Length = 433 Score = 283 bits (724), Expect = 7e-81 Identities = 152/411 (36%), Positives = 223/411 (54%), Gaps = 9/411 (2%) Query: 16 AILRVTSGNFLEQFDFFLFGFYATYIARTFFPAESEFASLMLTFAVFGSGFLMRPVGAIV 75 AI+ GN LE FDF ++ F+A IA+ FFP ++ SL+L A FG GF MRPVG IV Sbjct: 23 AIIATVLGNGLEWFDFTVYSFFAVIIAKLFFPTGNDLTSLLLAVATFGVGFFMRPVGGIV 82 Query: 76 LGAYIDRIGRRKGLMVTLAIMGCGTLLIALVPGYQTIGLAAPALVLLGRLLQGFSAGVEL 135 LG Y D++GR+ L +T+ +M GT LI + P YQ IGL AP L+++ RLLQGFSAG E+ Sbjct: 83 LGVYADKVGRKAALSLTILLMAGGTALIGIAPTYQQIGLWAPVLIVIARLLQGFSAGGEM 142 Query: 136 GGVSVYLSEIATPGNKGFYTSWQSASQQVAIVVAALIGYSLNITLGHDAISEWGWRIPFF 195 G + +L+E A + +Y+SW +S A+++ A +G + +L +A+ WGWR+PF Sbjct: 143 GSATAFLTEYAPANKRAYYSSWIQSSIGFAVLLGAAVGTFVTSSLSTEALHSWGWRMPFL 202 Query: 196 IGCMIIPLIFVLRRSLQETEAFL----QRKHRPDTREIFATIAKNWRIITAGTLLVAMTT 251 IG +I P+ + +R + ET AF + K E+F R A +V + T Sbjct: 203 IGMLIGPVGYFIRSRMDETPAFSAVADEAKDDSPLAEVFRRFP---RETFASFSMVILWT 259 Query: 252 TTFYFITVYTPTYGRTVLNLSARDSLIVTMLVGVSNFIWLPIGGAISDRIGRRAVLMGIT 311 Y + Y PTY L+L + M G + P+ G ++DR GRR L G Sbjct: 260 VCTYVLLFYMPTYSVRTLHLPQSTGFLAGMFGGSMIMCFAPVVGKLADRYGRRRFLSGAA 319 Query: 312 LLALITTWPVMQWLTAAPDFTRMTLVLLWFSFFFGMYNGAMVAALTEVMPVYVRTVGFSL 371 +L L+ WP+ ++ AP + + F Y G ++AA +E+ P V + G S+ Sbjct: 320 VLILVLAWPMFAYINRAPGLASLMVFQGVFGLLIAAYTGPILAAFSELFPTKVLSTGLSV 379 Query: 372 AFSLATAIFGGLTPAISTALVKLTGDKSSPGWWLMCAALCGLAATAMLFVR 422 A++ A IFGG P T L+ TG +P +++M AA L T FVR Sbjct: 380 AYNFAVTIFGGFAPFFITWLIASTGSNMAPAFYVMIAAAISLTGT--FFVR 428 Lambda K H 0.329 0.140 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 514 Number of extensions: 33 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 433 Length adjustment: 32 Effective length of query: 402 Effective length of database: 401 Effective search space: 161202 Effective search space used: 161202 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory