Align ABC transporter for L-Arginine and L-Citrulline, periplasmic substrate-binding component (characterized)
to candidate H281DRAFT_06484 H281DRAFT_06484 amino acid ABC transporter substrate-binding protein, PAAT family
Query= reanno::pseudo1_N1B4:Pf1N1B4_3431 (257 letters) >FitnessBrowser__Burk376:H281DRAFT_06484 Length = 266 Score = 233 bits (594), Expect = 3e-66 Identities = 111/231 (48%), Positives = 156/231 (67%), Gaps = 1/231 (0%) Query: 21 ADEKPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCEEMKVKCVWVEQEFDGLIPALK 80 AD K ++ G+EA+Y PF SK+P G + GFD D+GNA+C ++K KCVWVE FDGLIPAL+ Sbjct: 29 ADIKEVRFGVEASYAPFESKSPSGELQGFDIDVGNAVCAKLKAKCVWVENSFDGLIPALQ 88 Query: 81 VRKIDAILSSMSITEDRKKSVDFTNKYYNTPARLVMKAGTAVSENLAELKGKNIGVQRGS 140 RK +AI S M+IT+ R+++VDFT+ Y P +++ K G+ + A LKGK++GV +G+ Sbjct: 89 ARKFNAINSDMTITDQRRQAVDFTDPIYTIPNQMIAKKGSGLLPTPASLKGKHVGVLQGT 148 Query: 141 IHERFAREVLAPLGAEIKPYGSQNEIYLDVAAGRLDGTVADATLLDDGFLKTDAGKGFAF 200 I E +A+ AP G ++ PY +Q++IY D+A+GRLD + DA GFLK G GF F Sbjct: 149 IQETYAKARWAPAGVDVVPYQTQDQIYADLASGRLDASFQDAEAASKGFLKKPQGAGFEF 208 Query: 201 VGPAFTDVKYFGDGVGIAVRKGD-ALKDKINTAIAAIRENGKYKQIQDKYF 250 GPA +D K G GVG +RKGD ALKD +N A+ ++ +G + KYF Sbjct: 209 AGPAVSDEKLLGAGVGFGIRKGDAALKDALNQALKELKADGTIDRFAAKYF 259 Lambda K H 0.318 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 266 Length adjustment: 25 Effective length of query: 232 Effective length of database: 241 Effective search space: 55912 Effective search space used: 55912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory