Align ABC transporter substrate-binding protein; SubName: Full=Histidine transport system substrate-binding protein (characterized, see rationale)
to candidate H281DRAFT_03659 H281DRAFT_03659 amino acid ABC transporter substrate-binding protein, PAAT family
Query= uniprot:A0A1N7UK26 (258 letters) >FitnessBrowser__Burk376:H281DRAFT_03659 Length = 284 Score = 217 bits (553), Expect = 2e-61 Identities = 122/257 (47%), Positives = 161/257 (62%), Gaps = 10/257 (3%) Query: 3 PLRSLFAALLLPLCATAHAQEWKEIRFGVFPEYPPFESVAADGSLQGFDIELGNAICAKL 62 PL AAL+ + A+A E +R G+ P YPP +S A DGSL+GFD++LGN IC ++ Sbjct: 33 PLMIFGAALMFSV--GAYAAESNTLRLGIDPSYPPMDSKAPDGSLKGFDVDLGNEICRRI 90 Query: 63 EVKCTWVHNEFDGMIPALRARKFDAIMSSMAVTPAREKIIDFSDRLFLSPTSVITRKSAD 122 + +C WV EF GMIPAL+ARK DAI+SSMA+T RE+ I F+ +LF + +I R+ + Sbjct: 91 QARCQWVELEFSGMIPALQARKIDAILSSMAITQKREQQILFTSKLFQFKSRLIARQGSP 150 Query: 123 FGDTPESLMGKQVGVLQGSLQEAYARAHLAKLGAQIKAYQSQDQNYADLQNGRLDATLTD 182 ++L GKQ+GV G+ E YA H LGA + AY+SQD+ +ADLQNGRLD L Sbjct: 151 LAAGLQALSGKQIGVQSGTQFEGYALTHWVPLGAHVVAYKSQDEVFADLQNGRLDGALLG 210 Query: 183 KLEAQLNFLSKPEGSDFKTGPAFKDPTLPL---DIAMGLRKNDQALRALINKGIAAVQAD 239 +EA FL P G F AF L + +GLRK++ A++A IN IAA+ D Sbjct: 211 SVEADFGFLRTPAGKGF----AFVGEPLSMGDRGTGIGLRKDETAIQASINAAIAAMLKD 266 Query: 240 GTYAQIQKKYFGDQDIY 256 GTYAQI KKYF D D Y Sbjct: 267 GTYAQIAKKYF-DFDPY 282 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 284 Length adjustment: 25 Effective length of query: 233 Effective length of database: 259 Effective search space: 60347 Effective search space used: 60347 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory