Align ABC transporter substrate-binding protein; SubName: Full=Histidine transport system substrate-binding protein (characterized, see rationale)
to candidate H281DRAFT_06484 H281DRAFT_06484 amino acid ABC transporter substrate-binding protein, PAAT family
Query= uniprot:A0A1N7UK26 (258 letters) >FitnessBrowser__Burk376:H281DRAFT_06484 Length = 266 Score = 230 bits (586), Expect = 3e-65 Identities = 120/252 (47%), Positives = 161/252 (63%), Gaps = 3/252 (1%) Query: 2 TPLRSLFAALLLPLCA-TAHAQEWKEIRFGVFPEYPPFESVAADGSLQGFDIELGNAICA 60 T +LFA + A +A A + KE+RFGV Y PFES + G LQGFDI++GNA+CA Sbjct: 8 TAALALFATATATVTAGSAAAADIKEVRFGVEASYAPFESKSPSGELQGFDIDVGNAVCA 67 Query: 61 KLEVKCTWVHNEFDGMIPALRARKFDAIMSSMAVTPAREKIIDFSDRLFLSPTSVITRKS 120 KL+ KC WV N FDG+IPAL+ARKF+AI S M +T R + +DF+D ++ P +I +K Sbjct: 68 KLKAKCVWVENSFDGLIPALQARKFNAINSDMTITDQRRQAVDFTDPIYTIPNQMIAKKG 127 Query: 121 ADFGDTPESLMGKQVGVLQGSLQEAYARAHLAKLGAQIKAYQSQDQNYADLQNGRLDATL 180 + TP SL GK VGVLQG++QE YA+A A G + YQ+QDQ YADL +GRLDA+ Sbjct: 128 SGLLPTPASLKGKHVGVLQGTIQETYAKARWAPAGVDVVPYQTQDQIYADLASGRLDASF 187 Query: 181 TDKLEAQLNFLSKPEGSDFK-TGPAFKD-PTLPLDIAMGLRKNDQALRALINKGIAAVQA 238 D A FL KP+G+ F+ GPA D L + G+RK D AL+ +N+ + ++A Sbjct: 188 QDAEAASKGFLKKPQGAGFEFAGPAVSDEKLLGAGVGFGIRKGDAALKDALNQALKELKA 247 Query: 239 DGTYAQIQKKYF 250 DGT + KYF Sbjct: 248 DGTIDRFAAKYF 259 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 266 Length adjustment: 25 Effective length of query: 233 Effective length of database: 241 Effective search space: 56153 Effective search space used: 56153 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory