Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate H281DRAFT_05293 H281DRAFT_05293 amino acid ABC transporter ATP-binding protein, PAAT family
Query= uniprot:A0A1N7U8S3 (276 letters) >FitnessBrowser__Burk376:H281DRAFT_05293 Length = 263 Score = 287 bits (734), Expect = 2e-82 Identities = 151/254 (59%), Positives = 192/254 (75%), Gaps = 3/254 (1%) Query: 22 TAAIKLQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAG 81 TA + L V+ IHK +G+H VLKG+SL+A QGDVIS++GASGSGKST LRC+N LE PD G Sbjct: 4 TAPVALSVKNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDG 63 Query: 82 VITLDGISIEMRQGRAGTRAPH-QDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRV 140 + L G ++M++ G P + Q+ +R++L MVFQ+FNLWSHMTVLEN+ P RV Sbjct: 64 SVALAGEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRV 123 Query: 141 LDVSAAEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPT 200 S AE+ + A L KVGL + YPA LSGGQQQRVAIARALAM P+++LFDEPT Sbjct: 124 QKRSRAESVEEAEALLAKVGLAEK-RGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPT 182 Query: 201 SALDPELVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGRVEEHGDA-RIL 259 SALDPELVGEVL+V+++LAEEGRTML+VTHEMGFAR VS++V+FLHQG+VE G + Sbjct: 183 SALDPELVGEVLRVMRSLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVF 242 Query: 260 DQPNSERLQQFLSN 273 + SER +QF+S+ Sbjct: 243 VECKSERFRQFVSS 256 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 263 Length adjustment: 25 Effective length of query: 251 Effective length of database: 238 Effective search space: 59738 Effective search space used: 59738 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory